NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Dematin - Mus musculus - NucEnvDB

Dematin (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Dematin
Accession Code	Q9WV69
Gene	Dmtn
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 405)
MERLQKQPLTSPGSVSSSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTYSLLEHVELPRSRECSLSPKSTSPPPSPEVWAESRTLGIISQASTPRTTGTPRTSLPHFHH PETTRPDSNIYKKPPIYKQRESVGGSPQSKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKASRKGAEEEEEEEDDDSEEEIKAIRERQKEELSKVTSNLGKMILKEEMEKS LPIRRKTRSLPDRTPFHTSLHSGTSKSSSLPSYGRTTLSRLQSTEFSPSGSEAGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKL ALWKRNELKKKASLF

Subcellular Location

Description
Cytoplasm {By Similarity}. Cytoplasm, cytosol {Experimental EvidencePubMed:18505823}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:18505823}. Cytoplasm, cytoskeleton {By Similarity}. Cell membrane {By Similarity}. Membrane {Experimental EvidencePubMed:18505823}. Endomembrane system {By Similarity}. Cell projection {Experimental EvidencePubMed:18505823}. Note=Localized at the spectrin-actin junction of erythrocyte plasma membrane. Localized to intracellular membranes and the cytoskeletal network. Localized at intracellular membrane-bounded organelle compartment in platelets that likely represent the dense tubular network membrane (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Actin Cytoskeleton (GO:0015629) Actin Filament (GO:0005884) Cell Projection Membrane (GO:0031253) Cortical Cytoskeleton (GO:0030863) Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Endomembrane System (GO:0012505) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Platelet Dense Tubular Network Membrane (GO:0031095) Postsynaptic Density (GO:0014069) Spectrin-Associated Cytoskeleton (GO:0014731)

Biology & Function

Description
Membrane-cytoskeleton-associated protein with F-actin-binding activity that induces F-actin bundles formation and stabilization. Its F-actin-bundling activity is reversibly regulated upon its phosphorylation by the cAMP-dependent protein kinase A (PKA). Binds to the erythrocyte membrane glucose transporter-1 SLC2A1/GLUT1, and hence stabilizes and attaches the spectrin-actin network to the erythrocytic plasma membrane. Plays a role in maintaining the functional integrity of PKA-activated erythrocyte shape and the membrane mechanical properties. Also plays a role as a modulator of actin dynamics in fibroblasts; acts as negative regulator of the RhoA activation pathway. In platelets, functions as a regulator of internal calcium mobilization across the dense tubular system that affects platelet granule secretion pathways and aggregation. Also required for the formation of a diverse set of cell protrusions, such as filopodia and lamellipodia, necessary for platelet cell spreading, motility and migration. Acts as a tumor suppressor and inhibits malignant cell transformation. {Experimental EvidencePubMed:12011427, Experimental EvidencePubMed:18505823, Experimental EvidencePubMed:23060452}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Actin Filament Bundle Assembly (GO:0051017) Actin Filament Capping (GO:0051693) Actin Filament Reorganization (GO:0090527) Calcium-Mediated Signaling Using Extracellular Calcium Source (GO:0035585) Calcium-Mediated Signaling Using Intracellular Calcium Source (GO:0035584) Cellular Response To Calcium Ion (GO:0071277) Cellular Response To CAMP (GO:0071320) Erythrocyte Development (GO:0048821) Lamellipodium Assembly (GO:0030032) Negative Regulation Of Cell-Substrate Adhesion (GO:0010812) Negative Regulation Of Focal Adhesion Assembly (GO:0051895) Negative Regulation Of Peptidyl-Serine Phosphorylation (GO:0033137) Negative Regulation Of Peptidyl-Threonine Phosphorylation (GO:0010801) Negative Regulation Of Peptidyl-Tyrosine Phosphorylation (GO:0050732) Negative Regulation Of Protein Targeting To Membrane (GO:0090315) Negative Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900025) Positive Regulation Of Blood Coagulation (GO:0030194) Positive Regulation Of Fibroblast Migration (GO:0010763) Positive Regulation Of Integrin-Mediated Signaling Pathway (GO:2001046) Positive Regulation Of Platelet Aggregation (GO:1901731) Positive Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900026) Positive Regulation Of Wound Healing (GO:0090303) Protein Secretion By Platelet (GO:0070560) Protein-Containing Complex Assembly (GO:0065003) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Regulation Of Cell Shape (GO:0008360) Regulation Of Filopodium Assembly (GO:0051489) Regulation Of Lamellipodium Assembly (GO:0010591)
Molecular Function	Actin Binding (GO:0003779) Actin Filament Binding (GO:0051015) Protein Self-Association (GO:0043621) Signaling Receptor Binding (GO:0005102) Spectrin Binding (GO:0030507)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
P63104	14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-6271507	0.35

Cross-References

Database	Links
UNIPROT	Q9WV69 F8WIF9 Q3TYC5 Q8JZV5 Q9WVM2
Pfam	PF16182 PF02209
PROSITE	PS51089

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK