NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Protein bicaudal D homolog - Caenorhabditis elegans - NucEnvDB

Protein bicaudal D homolog (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein bicaudal D homolog
Accession Code	V6CJ04
Gene	bicd
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 737)
MAESELEKLRQDIAILTEKYEQAKEDIHKAANAGLELLRQKEDLEKRLAEMQAELDLARTEIDKTNQTLAEYRSQHQRSTRSELENEESLLEESSAKEEEYLQRIAKLEADLKKKEQELAEKKEELESIE KKHSKEIDSGAALEDERRKLRAELKETKEREQRLISEYSELEEENIGLQKTVANLRGSQVEYESLRIDNNRLEETIEIMKMAAEEDEILRVIADKQLEEALLTAQQERDQRLAMKRELEQTRNAEHISSL NDMLFGLERLGEDGELPPPQPGASDLFSELQGSSDVKVRELEAAKEGLQEELKSREKIFIEFVTGLADTLNIHRPTNELDYMHARQQKDVVLEKIQNIARDTDRHDKEGEEKRSGILKADLRTLVLVAGE KSAQLAAAQDAMIQVSDQLYQFYHQMTQNQGVQTEKSVQEIVKKLRLLARANAEDVPRVSLADEGVESGTETDVNASRSIPLNSDRLVIAPSFAKEIEKKLASVKIGDVLSETDLRQRILTEGNAISETT ESLKKMIQVVKRTSEQAFNQAVMASGAENEIEMQNMKLRSLLSTKRDQISTLRTVLKSNKLTAESALTSMREKYESEKKMMMEINDKMRRELKQLKEDAATFASHRAMFTARGEELKSKVEELSNELRAN EEEKKTLNQLLRLAIQQKLTLTQRLEEVEVDRDRQVFKRSSTRAPTRETYQPPRAVRYPGSTTTAQQPAPSSSGGSRGGPRRGDNQQ

Subcellular Location

Description
Nucleus envelope {Curator InferencePubMed:20005871}. Perikaryon {Experimental EvidencePubMed:21205795}. Cell projection, dendrite {Experimental EvidencePubMed:21205795}. Note=Probably recruited to the nuclear envelope by unc-83. {Curator InferencePubMed:20005871}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Dendrite (GO:0030425) Golgi Apparatus (GO:0005794) Microtubule Associated Complex (GO:0005875) Neuronal Cell Body (GO:0043025) Nuclear Envelope (GO:0005635) Perikaryon (GO:0043204)

Biology & Function

Description
Part of a complex with dlc-1 and egal-1, which is recruited to the nuclear envelope by unc-83, where in turn, it recruits dynein to the nuclear surface and regulates nuclear migration in hypodermal precursor cells (PubMed:20005871) (Probable). Required for the formation of dendritic branches of PVD sensory neurons (PubMed:21205795). {Experimental EvidencePubMed:20005871, Experimental EvidencePubMed:21205795, Curator InferencePubMed:27697906}.
Assigned Ontology terms

Biological Process	Microtubule Anchoring At Microtubule Organizing Center (GO:0072393) Nervous System Development (GO:0007399) Nuclear Migration Along Microtubule (GO:0030473) Protein Localization To Organelle (GO:0033365) Regulation Of Dendrite Morphogenesis (GO:0048814) Regulation Of Microtubule Cytoskeleton Organization (GO:0070507)
Molecular Function	Cytoskeletal Anchor Activity (GO:0008093) Dynactin Binding (GO:0034452) Dynein Complex Binding (GO:0070840)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q17902	Egalitarian protein homolog	EBI-2903351	0.51
Q23064	Nuclear migration protein unc-83	EBI-2905267	0.51
Interactions with other proteins (4 interactors)

Partner (UniProt)		IntAct	Confidence score
O01590	ACaD (ACAD, acyl-CoA Dehydrogenase) Sequence homolog	EBI-2414739	0.49
Q22771	Uncharacterized protein	EBI-2414746	0.49
Q9N4I1	DyNactin Complex component	EBI-6460281	0.37
Q9XVN3	Apoptotic enhancer 1 protein (Ce-iASPP) (Inhibitor member of the ASPP family) (Protein iASPP)	EBI-6534816	0.37

Cross-References

Database	Links
UNIPROT	V6CJ04 V6CK55
Pfam	PF09730

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK