Protein Information |
|
|---|---|
| Protein Name | Fibronectin type III and SPRY domain-containing protein 2 |
| Accession Code | A1L4K1 |
| Gene | FSD2 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 749) | |
|
MEEESGEELGLDRSTPKDFHFYHMDLYDSEDRLHLFPEENTRMRKVVQAEMANESRGAGDGKAQRDLQEEVDELVHLYGLEDDHELGDEFVDENIPRTGVSEYPPYMMKRRDPAREQRDWRLSGEAAEAE DLGFGGWGSAGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAADVFCVTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIEMENFANHLEEVFITVEENFGKQEQNFESHYN EILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENLDTCKELMETIEEMCHEEKVDFIKDAVAMADRLGKFLKTKTDVEISAQPEFEDQTLDFSDVEQLMGSINTIPAPSAPVINPQVPNSATGSSV RVCWSLYSDDTVESYQLSYRPVQDSSPGTDQAEFTVTVKETYCSVTNLVPNTQYEFWVTAHNRAGPSPSSERAVYMTAPSPPIIKTKEIRSCEEAVLICWESGNLNPVDSYTVELTQAESPEASGVTESV VGIPTCESVVQLQPGRSYIIYVRALNMGGPSVRSEPATVHTIGSYFRLNKDTCHPWLTISEDGLTAVRSERRTPARELSPSDTHFTRCVAVMGNLIPVRGHHYWEVEVDEHLDYRVGVAFADVRKQEDLG ANCLSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYEHSKLSFFNVDLSQHLYTFSCQLHEFVHPCFSLEKPGCLKVHNGISMPKHVTFY |
|
Description |
||
|---|---|---|
| Nucleus {By SimilarityUniProtKB:H0UZ81}. Sarcoplasmic reticulum {By SimilarityUniProtKB:H0UZ81}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:H0UZ81}. Note=In skeletal muscles and striated muscles flanks Z-disks. Partially colocalizes with RYR2 in the sarcoplasmic reticulum. {By SimilarityUniProtKB:H0UZ81}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Sarcoplasmic Reticulum (GO:0016529) |
|
Description |
|
|---|---|
Assigned Ontology terms |
|
| Biological Process | |
| Molecular Function | |
Interactions with Nuclear Envelope proteins (3 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O95295 | SNARE-associated protein Snapin | EBI-24500672 | 0.56 |
| O60645 | Exocyst complex component 3 | EBI-25258050 | 0.56 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-10224474 | 0.56 | Interactions with other proteins (93 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q14324 | Myosin-binding protein C, fast-type (Fast MyBP-C) (C-protein, skeletal muscle fast isoform) | EBI-5661041 | 0.00 |
| Q7Z3I7 | Zinc finger protein 572 | EBI-10172604 | 0.60 |
| Q7Z3B3 | KAT8 regulatory NSL complex subunit 1 (MLL1/MLL complex subunit KANSL1) (MSL1 homolog 1) (hMSL1v1) (NSL complex protein NSL1) (Non-specific lethal 1 homolog) | EBI-10178303 | 0.56 |
| O95990 | Actin-associated protein FAM107A (Down-regulated in renal cell carcinoma 1) (Protein TU3A) | EBI-10192906 | 0.56 |
| P10768 | S-formylglutathione hydrolase (FGH) (EC 3.1.2.12) (Esterase D) (Methylumbelliferyl-acetate deacetylase) (EC 3.1.1.56) | EBI-10197227 | 0.78 |
| P17024 | Zinc finger protein 20 (Zinc finger protein KOX13) | EBI-10199416 | 0.56 |
| P28070 | Proteasome subunit beta type-4 (26 kDa prosomal protein) (HsBPROS26) (PROS-26) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome beta chain) (Proteasome chain 3) (HsN3) | EBI-10204607 | 0.56 |
| P29972 | Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Urine water channel) (Water channel protein for red blood cells and kidney proximal tubule) | EBI-10204944 | 0.56 |
| P31146 | Coronin-1A (Coronin-like protein A) (Clipin-A) (Coronin-like protein p57) (Tryptophan aspartate-containing coat protein) (TACO) | EBI-10205786 | 0.78 |
| Q00994 | Protein BEX3 (Brain-expressed X-linked protein 3) (Nerve growth factor receptor-associated protein 1) (Ovarian granulosa cell 13.0 kDa protein HGR74) (p75NTR-associated cell death executor) | EBI-10222282 | 0.72 |
| Q08117 | TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator) | EBI-10224779 | 0.67 |
| Q14738 | Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform (PP2A B subunit isoform B'-delta) (PP2A B subunit isoform B56-delta) (PP2A B subunit isoform PR61-delta) (PP2A B subunit isoform R5-delta) | EBI-10233892 | 0.56 |
| Q15973 | Zinc finger protein 124 (Zinc finger protein HZF-16) | EBI-10237322 | 0.56 |
| Q16670 | Zinc finger and SCAN domain-containing protein 26 (Protein SRE-ZBP) (Zinc finger protein 187) | EBI-10238175 | 0.56 |
| Q3B820 | Protein FAM161A | EBI-10240125 | 0.56 |
| Q53FD0 | Zinc finger C2HC domain-containing protein 1C | EBI-10242267 | 0.56 |
| Q5JS98 | Pre-B-cell leukemia transcription factor 3 | EBI-10244397 | 0.56 |
| Q6NYC8 | Phostensin (Protein phosphatase 1 F-actin cytoskeleton-targeting subunit) (Protein phosphatase 1 regulatory subunit 18) | EBI-10251682 | 0.72 |
| Q6P1J9 | Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein) | EBI-10252260 | 0.78 |
| Q6PJG3 | LATS1 protein (Serine/threonine-protein kinase LATS1) | EBI-10253974 | 0.56 |
| Q86VK4 | Zinc finger protein 410 (Another partner for ARF 1) | EBI-10259792 | 0.56 |
| Q86YD7 | Protein FAM90A1 | EBI-10260722 | 0.72 |
| Q8IY31 | Intraflagellar transport protein 20 homolog (hIFT20) | EBI-10262646 | 0.56 |
| Q8N381 | Phosphoinositide-3-kinase, regulatory subunit 3 (Gamma) | EBI-10265171 | 0.56 |
| Q8N8B7 | Transcription elongation factor A N-terminal and central domain-containing protein (TFIIS central domain-containing protein 1) | EBI-10267719 | 0.56 |
| Q8NEF3 | Coiled-coil domain-containing protein 112 (Mutated in bladder cancer protein 1) | EBI-10270620 | 0.56 |
| Q8TAU3 | Zinc finger protein 417 | EBI-10272085 | 0.72 |
| Q8TD31 | Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8) | EBI-10274456 | 0.72 |
| Q96BZ8 | Leukocyte receptor cluster member 1 | EBI-10282596 | 0.72 |
| Q96NC0 | Zinc finger matrin-type protein 2 | EBI-10291592 | 0.56 |
| Q96SQ5 | Zinc finger protein 587 | EBI-10293466 | 0.72 |
| Q9BXY8 | Protein BEX2 (Brain-expressed X-linked protein 2) (hBex2) | EBI-10301478 | 0.56 |
| Q9H0A9 | Speriolin-like protein (Spermatogenesis and centriole-associated protein 1-like protein) | EBI-10304145 | 0.60 |
| Q9H0E9 | Bromodomain-containing protein 8 (Skeletal muscle abundant protein) (Skeletal muscle abundant protein 2) (Thyroid hormone receptor coactivating protein of 120 kDa) (TrCP120) (p120) | EBI-10304359 | 0.72 |
| Q9H6F0 | cDNA: FLJ22332 fis, clone HRC05753 | EBI-10307479 | 0.56 |
| Q9H788 | SH2 domain-containing protein 4A (Protein SH(2)A) (Protein phosphatase 1 regulatory subunit 38) | EBI-10308323 | 0.72 |
| Q9HC52 | Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3) (hPc3) (Rectachrome 1) | EBI-10310314 | 0.72 |
| Q9P0T4 | Zinc finger protein 581 | EBI-10317754 | 0.72 |
| Q9UGP5 | DNA polymerase lambda (Pol Lambda) (EC 2.7.7.7) (EC 4.2.99.-) (DNA polymerase beta-2) (Pol beta2) (DNA polymerase kappa) | EBI-10320763 | 0.60 |
| Q9UIE0 | Zinc finger protein 230 (Zinc finger protein FDZF2) | EBI-10321904 | 0.56 |
| Q9Y3B7 | 39S ribosomal protein L11, mitochondrial (L11mt) (MRP-L11) (Mitochondrial large ribosomal subunit protein uL11m) | EBI-10327384 | 0.72 |
| Q8IXW7 | FMR1 protein (Fragile X messenger ribonucleoprotein 1) (Truncated FMRP) | EBI-21249370 | 0.37 |
| Q99608 | Necdin | EBI-21251010 | 0.37 |
| Q9H0I2 | Enkurin domain-containing protein 1 | EBI-24276119 | 0.56 |
| Q8TBB1 | E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX) | EBI-24292204 | 0.56 |
| Q9P1Y5 | Calmodulin-regulated spectrin-associated protein 3 (Protein Nezha) | EBI-24292226 | 0.56 |
| Q9H9D4 | Zinc finger protein 408 (PR domain zinc finger protein 17) | EBI-24302090 | 0.56 |
| Q5T619 | Zinc finger protein 648 | EBI-24309981 | 0.56 |
| Q96EG3 | Zinc finger protein 837 | EBI-24311294 | 0.56 |
| Q96AL5 | PBX3 protein | EBI-24314166 | 0.56 |
| Q8IVT4 | Hypothetical MGC50722 | EBI-24315626 | 0.56 |
| Q6NX45 | Zinc finger protein 774 | EBI-24321517 | 0.56 |
| Q9BT49 | THAP domain-containing protein 7 | EBI-24325694 | 0.56 |
| Q9BWG6 | Sodium channel modifier 1 | EBI-24340348 | 0.56 |
| Q96HB5 | Coiled-coil domain-containing protein 120 | EBI-24349830 | 0.56 |
| Q9UK33 | Zinc finger protein 580 (LDL-induced EC protein) | EBI-24352123 | 0.56 |
| P78358 | Cancer/testis antigen 1 (Autoimmunogenic cancer/testis antigen NY-ESO-1) (Cancer/testis antigen 6.1) (CT6.1) (L antigen family member 2) (LAGE-2) | EBI-24352383 | 0.56 |
| Q96EZ8 | Microspherule protein 1 (58 kDa microspherule protein) (Cell cycle-regulated factor p78) (INO80 complex subunit J) (MCRS2) | EBI-24352759 | 0.56 |
| Q8WWY3 | U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31) | EBI-24355284 | 0.56 |
| O76064 | E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8) | EBI-24355797 | 0.56 |
| Q9ULM2 | Zinc finger protein 490 | EBI-24362843 | 0.56 |
| Q96HP4 | Oxidoreductase NAD-binding domain-containing protein 1 (EC 1.-.-.-) | EBI-25253734 | 0.56 |
| O43602 | Neuronal migration protein doublecortin (Doublin) (Lissencephalin-X) (Lis-X) | EBI-25254540 | 0.56 |
| P0CB47 | Upstream-binding factor 1-like protein 1 | EBI-25255462 | 0.56 |
| P56524 | Histone deacetylase 4 (HD4) (EC 3.5.1.98) | EBI-25255284 | 0.56 |
| Q3SY00 | Testis-specific protein 10-interacting protein (Tsga10-interacting protein) | EBI-25255985 | 0.56 |
| Q9P2K3 | REST corepressor 3 | EBI-24366860 | 0.56 |
| P13682 | Zinc finger protein 35 (Zinc finger protein HF.10) | EBI-24478087 | 0.56 |
| Q07002 | Cyclin-dependent kinase 18 (EC 2.7.11.22) (Cell division protein kinase 18) (PCTAIRE-motif protein kinase 3) (Serine/threonine-protein kinase PCTAIRE-3) | EBI-24478674 | 0.56 |
| Q969G3 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (BRG1-associated factor 57) (BAF57) | EBI-24492471 | 0.56 |
| Q2TBE0 | CWF19-like protein 2 | EBI-24508217 | 0.56 |
| O14964 | Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110) | EBI-24370108 | 0.56 |
| Q8TAB5 | UPF0500 protein C1orf216 | EBI-24382819 | 0.56 |
| O43482 | Protein Mis18-beta (Cancer/testis antigen 86) (CT86) (Opa-interacting protein 5) (OIP-5) | EBI-24385225 | 0.56 |
| Q14119 | Vascular endothelial zinc finger 1 (Putative transcription factor DB1) (Zinc finger protein 161) | EBI-24388342 | 0.56 |
| Q2TBA0 | Kelch-like protein 40 (Kelch repeat and BTB domain-containing protein 5) (Sarcosynapsin) | EBI-24398616 | 0.56 |
| Q99633 | Pre-mRNA-splicing factor 18 (PRP18 homolog) (hPRP18) | EBI-24401399 | 0.56 |
| Q5W5X9 | Tetratricopeptide repeat protein 23 (TPR repeat protein 23) (Cervical cancer proto-oncogene 8 protein) (HCC-8) | EBI-25260730 | 0.56 |
| Q9ULD5 | Zinc finger protein 777 | EBI-24422254 | 0.56 |
| Q6ZNE5 | Beclin 1-associated autophagy-related key regulator (Barkor) (Autophagy-related protein 14-like protein) (Atg14L) | EBI-24423012 | 0.56 |
| Q9Y2P0 | Zinc finger protein 835 | EBI-24424287 | 0.56 |
| O60941 | Dystrobrevin beta (DTN-B) (Beta-dystrobrevin) | EBI-24426448 | 0.56 |
| O95363 | Phenylalanine--tRNA ligase, mitochondrial (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase) (PheRS) | EBI-24427910 | 0.56 |
| Q96PV4 | Paraneoplastic antigen-like protein 5 (Tumor antigen BJ-HCC-25) | EBI-24432894 | 0.56 |
| Q9BQ89 | Protein FAM110A | EBI-24438032 | 0.56 |
| P36508 | Zinc finger protein 76 (Zinc finger protein 523) | EBI-24445889 | 0.56 |
| P53365 | Arfaptin-2 (ADP-ribosylation factor-interacting protein 2) (Partner of RAC1) (POR1) | EBI-24447892 | 0.56 |
| Q8IYE0 | Coiled-coil domain-containing protein 146 | EBI-24463350 | 0.56 |
| Q9UJV3 | Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1) | EBI-24468925 | 0.56 |
| Q9Y247 | Protein FAM50B (Protein XAP-5-like) | EBI-24470709 | 0.56 |
| P46013 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67) | EBI-20562326 | 0.35 |
| Q9Y394 | Dehydrogenase/reductase SDR family member 7 (EC 1.1.1.-) (Retinal short-chain dehydrogenase/reductase 4) (retSDR4) (Short chain dehydrogenase/reductase family 34C member 1) (Protein SDR34C1) | EBI-20903160 | 0.40 |
| P40426 | Pre-B-cell leukemia transcription factor 3 (Homeobox protein PBX3) | EBI-22133174 | 0.37 |
Database | Links |
| UNIPROT | A1L4K1 B3KVG1 B7ZM02 |
| Pfam | PF00041 PF00622 |
| PROSITE | PS50188 PS50853 |
| DisGeNET | 123722 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory