Membrane-associated progesterone receptor component 2 - Homo sapiens

Membrane-associated progesterone receptor component 2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Membrane-associated progesterone receptor component 2
Accession Code	O15173
Gene	PGRMC2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 223)
MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDV TKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Subcellular Location

Description
Membrane {Curator InferencePubMed:23793472}; Single- pass membrane protein {Curator Inference}. Nucleus envelope {Experimental EvidencePubMed:27754849, Experimental EvidencePubMed:28111073}. Endoplasmic reticulum {Experimental EvidencePubMed:27754849}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endomembrane System (GO:0012505) Endoplasmic Reticulum (GO:0005783) Membrane (GO:0016020) Nuclear Envelope (GO:0005635)

Biology & Function

Description
Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan (By similarity). May serve as a universal non-classical progesterone receptor in the uterus (Probable). Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus (By similarity). Plays a role in adipocyte function and systemic glucose homeostasis (PubMed:28111073). In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1 (By similarity). {By SimilarityUniProtKB:Q80UU9, Experimental EvidencePubMed:28111073, Curator InferencePubMed:28396637}.
Assigned Ontology terms

Biological Process	Adipose Tissue Development (GO:0060612)
Molecular Function	Heme Binding (GO:0020037) Heme Transmembrane Transporter Activity (GO:0015232) Nuclear Steroid Receptor Activity (GO:0003707) Steroid Binding (GO:0005496)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (11 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A0A142I5B9	RNA-directed RNA polymerase NS5	EBI-20626314	0.35
Q9WMX2	RNA-directed RNA polymerase	EBI-11513489	0.35
Q9P0L0	Vesicle-associated membrane protein-associated protein A	EBI-24691023	0.56
Q80UU9	Membrane-associated progesterone receptor component 2	EBI-12523269	0.35
Q9BVC6	Transmembrane protein 109	EBI-20900351	0.40
Q925D4	Transmembrane protein 176B	EBI-22259161	0.35
O95476	CTD nuclear envelope phosphatase 1	EBI-27115722	0.27
P03246	E1B protein, small T-antigen	EBI-11722343	0.35
O14681	Etoposide-induced protein 2.4 homolog	EBI-24712104	0.56
Q8IWB1	Inositol 1,4,5-trisphosphate receptor-interacting protein	EBI-23781080	0.56
P02545	Lamin-A/C	EBI-16795756	0.27
Interactions with other proteins (142 interactors)

Partner (UniProt)		IntAct	Confidence score
Q14164	Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i)	EBI-1083472	0.00
P0DOE9	Non-structural protein 1 (NS1) (Non-structural protein 1C)	EBI-6138583	0.35
Q77M19	V protein	EBI-6270503	0.35
P03182	Apoptosis regulator BHRF1 (Early antigen protein R) (EA-R) (Nuclear antigen)	EBI-11721938	0.35
P06460	Probable protein E5A	EBI-11723082	0.35
P06461	Probable protein E5B	EBI-11723785	0.35
P06792	Probable protein E5	EBI-11724527	0.35
P06927	Probable protein E5	EBI-11724813	0.35
P0CK49	Tegument protein UL51 homolog	EBI-11725356	0.35
P0C739	Protein BNLF2a	EBI-11725101	0.35
P0CK56	Uncharacterized protein BDLF4	EBI-11725466	0.35
P0CK58	Apoptosis regulator BALF1	EBI-11732874	0.35
P69901	Probable protein E5B	EBI-11733364	0.35
Q2MG95	BVLF1	EBI-11733653	0.35
Q5HYA8	Meckelin (Meckel syndrome type 3 protein) (Transmembrane protein 67)	EBI-11367583	0.27
Q6NUS6	Tectonic-3	EBI-11368748	0.27
Q86UK5	Limbin (Ellis-van Creveld syndrome protein 2) (EVC2)	EBI-11372136	0.27
Q86X19	Transmembrane protein 17	EBI-11372615	0.27
Q96GX1	Tectonic-2	EBI-11375285	0.27
Q9P0N5	Transmembrane protein 216	EBI-11378021	0.27
Q9NWU2	Glucose-induced degradation protein 8 homolog (Two hybrid-associated protein 1 with RanBPM) (Twa1)	EBI-12450239	0.51
Q96G75	E3 ubiquitin-protein transferase RMND5B (EC 2.3.2.27) (Protein RMD5 homolog B)	EBI-12452053	0.51
O95429	BAG family molecular chaperone regulator 4 (BAG-4) (Bcl-2-associated athanogene 4) (Silencer of death domains)	EBI-24341628	0.56
Q6UX40	Transmembrane protein 107	EBI-24668603	0.56
Q01453	Peripheral myelin protein 22 (PMP-22) (Growth arrest-specific protein 3) (GAS-3)	EBI-24674117	0.56
Q8N5I4	Dehydrogenase/reductase SDR family member on chromosome X (EC 1.1.-.-) (DHRSXY) (Short chain dehydrogenase/reductase family 46C member 1) (Short chain dehydrogenase/reductase family 7C member 6)	EBI-24674227	0.56
O60906	Sphingomyelin phosphodiesterase 2 (EC 3.1.4.12) (Lyso-platelet-activating factor-phospholipase C) (Lyso-PAF-PLC) (Neutral sphingomyelinase) (N-SMase) (nSMase) (nSMase1)	EBI-24683333	0.56
Q14656	Transmembrane protein 187 (Protein ITBA1)	EBI-24687401	0.56
P01031	Complement C5 (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4) [Cleaved into: Complement C5 beta chain; Complement C5 alpha chain; C5a anaphylatoxin; Complement C5 alpha' chain]	EBI-24694240	0.56
Q13021	MAL-like protein (Protein BENE)	EBI-24695750	0.56
Q8IVQ6	Palmitoyltransferase ZDHHC21 (EC 2.3.1.225) (DHHC domain-containing cysteine-rich protein 21) (DHHC-21) (Zinc finger DHHC domain-containing protein 21)	EBI-24706532	0.56
P59542	Taste receptor type 2 member 19 (Taste receptor type 2 member 23) (Taste receptor type 2 member 48) (T2R48)	EBI-24708148	0.56
Q7RTY0	Monocarboxylate transporter 13 (MCT 13) (Solute carrier family 16 member 13)	EBI-24708883	0.56
Q9NZ01	Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER)	EBI-24711415	0.56
O43681	ATPase GET3 (EC 3.6.-.-) (Arsenical pump-driving ATPase) (Arsenite-stimulated ATPase) (Guided entry of tail-anchored proteins factor 3, ATPase) (Transmembrane domain recognition complex 40 kDa ATPase subunit) (hARSA-I) (hASNA-I)	EBI-24715630	0.56
Q86UD5	Sodium/hydrogen exchanger 9B2 (Na(+)/H(+) exchanger NHA2) (Na(+)/H(+) exchanger-like domain-containing protein 2) (NHE domain-containing protein 2) (Sodium/hydrogen exchanger-like domain-containing protein 2) (Solute carrier family 9 subfamily B member 2)	EBI-24720671	0.56
Q8IWU4	Zinc transporter 8 (ZnT-8) (Solute carrier family 30 member 8)	EBI-24722592	0.56
O14569	Transmembrane reductase CYB561D2 (EC 7.2.1.3) (Cytochrome b561 domain-containing protein 2) (Putative tumor suppressor protein 101F6)	EBI-24726780	0.56
Q5RI15	Cytochrome c oxidase assembly protein COX20, mitochondrial	EBI-24727330	0.56
O00264	Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA)	EBI-24738362	0.56
O76064	E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8)	EBI-23831845	0.56
Q9Y5Y5	Peroxisomal membrane protein PEX16 (Peroxin-16) (Peroxisomal biogenesis factor 16)	EBI-23837903	0.56
Q9H2H9	Sodium-coupled neutral amino acid symporter 1 (Amino acid transporter A1) (N-system amino acid transporter 2) (Solute carrier family 38 member 1) (System A amino acid transporter 1) (System N amino acid transporter 1)	EBI-24767413	0.56
Q9H2L4	Transmembrane protein 60	EBI-24768625	0.56
O95159	Zinc finger protein-like 1 (Zinc finger protein MCG4)	EBI-24772852	0.56
O60636	Tetraspanin-2 (Tspan-2) (Tetraspan NET-3)	EBI-24779563	0.56
P11215	Integrin alpha-M (CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)	EBI-24786003	0.56
Q9UBY5	Lysophosphatidic acid receptor 3 (LPA receptor 3) (LPA-3) (Lysophosphatidic acid receptor Edg-7)	EBI-24793347	0.56
Q9BWQ6	Protein YIPF2 (YIP1 family member 2)	EBI-24796209	0.56
P02787	Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin)	EBI-24797200	0.56
Q9H3K2	Growth hormone-inducible transmembrane protein (Dermal papilla-derived protein 2) (Mitochondrial morphology and cristae structure 1) (MICS1) (Transmembrane BAX inhibitor motif-containing protein 5)	EBI-24797448	0.56
P78329	Cytochrome P450 4F2 (EC 1.14.14.1) (20-hydroxyeicosatetraenoic acid synthase) (20-HETE synthase) (Arachidonic acid omega-hydroxylase) (CYPIVF2) (Cytochrome P450-LTB-omega) (Docosahexaenoic acid omega-hydroxylase) (EC 1.14.14.79) (Leukotriene-B(4) 20-monooxygenase 1) (Leukotriene-B(4) omega-hydroxylase 1) (EC 1.14.14.94) (Phylloquinone omega-hydroxylase CYP4F2) (EC 1.14.14.78)	EBI-24798035	0.56
Q96H72	Zinc transporter ZIP13 (LIV-1 subfamily of ZIP zinc transporter 9) (LZT-Hs9) (Solute carrier family 39 member 13) (Zrt- and Irt-like protein 13) (ZIP-13)	EBI-25284904	0.56
Q96JF0	Beta-galactoside alpha-2,6-sialyltransferase 2 (Alpha 2,6-ST 2) (EC 2.4.3.1) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2) (ST6Gal II) (ST6GalII) (hST6Gal II) (Sialyltransferase 2)	EBI-25286104	0.56
Q96PS8	Aquaporin-10 (AQP-10) (Aquaglyceroporin-10) (Small intestine aquaporin)	EBI-24548121	0.56
Q7L5A8	Fatty acid 2-hydroxylase (EC 1.14.18.-) (Fatty acid alpha-hydroxylase) (Fatty acid hydroxylase domain-containing protein 1)	EBI-25146219	0.56
Q9H9B4	Sideroflexin-1	EBI-24642361	0.56
Q13277	Syntaxin-3	EBI-25147430	0.56
Q96GQ5	RUS family member 1	EBI-24650336	0.56
Q8N2M4	Lysoplasmalogenase-like protein TMEM86A (Transmembrane protein 86A)	EBI-24655777	0.56
I3L0A0	HCG2044781 (PEDS1-UBE2V1 readthrough)	EBI-24658689	0.56
Q9H0Q3	FXYD domain-containing ion transport regulator 6 (Phosphohippolin)	EBI-24746517	0.56
Q96HH6	Transmembrane protein 19	EBI-25185187	0.56
Q96IV6	Fatty acid hydroxylase domain-containing protein 2	EBI-24774155	0.56
O00124	UBX domain-containing protein 8 (Reproduction 8 protein) (Rep-8 protein) (UBX domain-containing protein 6)	EBI-25192578	0.56
A0A024RCD1	NAD(P)(+)--arginine ADP-ribosyltransferase (EC 2.4.2.31) (Mono(ADP-ribosyl)transferase)	EBI-24790520	0.56
Q9Y342	Plasmolipin (Plasma membrane proteolipid)	EBI-24803718	0.56
Q9BTX3	Transmembrane protein 208	EBI-24803996	0.56
Q9P0S3	ORM1-like protein 1 (Adoplin-1)	EBI-24804382	0.56
Q6ZPD8	Diacylglycerol O-acyltransferase 2-like protein 6 (EC 2.3.1.-) (Diacylglycerol O-acyltransferase candidate 3) (hDC3)	EBI-24804564	0.56
Q8N661	Lysoplasmalogenase (EC 3.3.2.2) (Transmembrane protein 86B)	EBI-25218050	0.56
Q6N075	Molybdate-anion transporter (Major facilitator superfamily domain-containing protein 5) (Molybdate transporter 2 homolog) (hsMOT2)	EBI-24807339	0.56
Q8TDV0	G-protein coupled receptor 151 (G-protein coupled receptor PGR7) (GPCR-2037) (Galanin receptor 4) (Galanin-receptor-like protein) (GalRL)	EBI-25267216	0.56
P22315	Ferrochelatase, mitochondrial (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase)	EBI-12523269	0.50
Q78IK4	MICOS complex subunit Mic27 (Apolipoprotein O-like) (Protein FAM121A)	EBI-12523269	0.35
Q8CI59	Metalloreductase STEAP3 (EC 1.16.1.-) (Dudulin-2) (Protein nm1054) (Six-transmembrane epithelial antigen of prostate 3) (Tumor suppressor-activated pathway protein 6)	EBI-12523269	0.35
Q62351	Transferrin receptor protein 1 (TR) (TfR) (TfR1) (Trfr) (CD antigen CD71)	EBI-12523269	0.35
Q9CR62	Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11)	EBI-12523269	0.35
Q60930	Voltage-dependent anion-selective channel protein 2 (VDAC-2) (mVDAC2) (Outer mitochondrial membrane protein porin 2) (Voltage-dependent anion-selective channel protein 6) (VDAC-6) (mVDAC6)	EBI-12523269	0.35
P51881	ADP/ATP translocase 2 (ADP,ATP carrier protein 2) (Adenine nucleotide translocator 2) (ANT 2) (Solute carrier family 25 member 5) [Cleaved into: ADP/ATP translocase 2, N-terminally processed]	EBI-12523269	0.35
P48962	ADP/ATP translocase 1 (ADP,ATP carrier protein 1) (ADP,ATP carrier protein, heart/skeletal muscle isoform T1) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4)	EBI-12523269	0.35
Q61102	Iron-sulfur clusters transporter ABCB7, mitochondrial (ATP-binding cassette sub-family B member 7, mitochondrial) (ATP-binding cassette transporter 7) (ABC transporter 7 protein)	EBI-12523269	0.35
Q9JI39	ATP-binding cassette sub-family B member 10, mitochondrial (ABC-mitochondrial erythroid protein) (ABC-me protein) (ATP-binding cassette transporter 10) (ABC transporter 10 protein)	EBI-12523269	0.35
Q9Z2I9	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial (EC 6.2.1.5) (ATP-specific succinyl-CoA synthetase subunit beta) (A-SCS) (Succinyl-CoA synthetase beta-A chain) (SCS-betaA)	EBI-12523269	0.35
P08680	5-aminolevulinate synthase, erythroid-specific, mitochondrial (ALAS-E) (EC 2.3.1.37) (5-aminolevulinic acid synthase 2) (Delta-ALA synthase 2) (Delta-aminolevulinate synthase 2)	EBI-12523269	0.35
P58281	Dynamin-like 120 kDa protein, mitochondrial (EC 3.6.5.5) (Large GTP-binding protein) (LargeG) (Optic atrophy protein 1 homolog) [Cleaved into: Dynamin-like 120 kDa protein, form S1]	EBI-12523269	0.35
Q8CAQ8	MICOS complex subunit Mic60 (Mitochondrial inner membrane protein) (Mitofilin)	EBI-12523269	0.35
O55022	Membrane-associated progesterone receptor component 1 (mPR)	EBI-12523269	0.35
Q8IWL3	Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial]	EBI-13943458	0.35
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.42
Q96I36	Cytochrome c oxidase assembly protein COX14	EBI-16791250	0.27
P11279	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	EBI-16794808	0.27
Q9HBL7	Plasminogen receptor (KT) (Plg-R(KT))	EBI-16797780	0.27
O43493	Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2)	EBI-16800265	0.27
Q9Y4C4	Malignant fibrous histiocytoma-amplified sequence 1 (Malignant fibrous histiocytoma-amplified sequence with leucine-rich tandem repeats 1)	EBI-20589710	0.44
Q83DF6	Putative ankyrin repeat protein CBU_0781	EBI-21285326	0.37
P05154	Plasma serine protease inhibitor (Acrosomal serine protease inhibitor) (Plasminogen activator inhibitor 3) (PAI-3) (PAI3) (Protein C inhibitor) (PCI) (Serpin A5)	EBI-20911464	0.40
P04233	HLA class II histocompatibility antigen gamma chain (HLA-DR antigens-associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide (CLIP)]	EBI-21258980	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
Q96GC9	Vacuole membrane protein 1 (Transmembrane protein 49)	EBI-21267986	0.35
M0R671	Tensin 2	EBI-22259161	0.35
F1LML3	Aldo-keto reductase family 1 member D1	EBI-22259161	0.35
F1LM93	Tyrosine-protein kinase Yes (EC 2.7.10.2) (p61-Yes)	EBI-22259161	0.35
A0A0G2K261	Isoleucine--tRNA ligase (EC 6.1.1.5) (Isoleucyl-tRNA synthetase)	EBI-22259161	0.35
Q5U2U8	BAG cochaperone 3 (Bcl2-associated athanogene 3) (RCG40209, isoform CRA_b)	EBI-22259161	0.35
Q5RKH1	Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1) (PRP4 pre-mRNA-processing factor 4 homolog)	EBI-22259161	0.35
D4A1H9	Cytochrome P450, family 4, subfamily f, polypeptide 39	EBI-22259161	0.35
D4A7J8	PRP4 pre-mRNA processing factor 4 homolog (Yeast) (Pre-mRNA-processing factor 4)	EBI-22259161	0.35
P42346	Serine/threonine-protein kinase mTOR (EC 2.7.11.1) (FK506-binding protein 12-rapamycin complex-associated protein 1) (FKBP12-rapamycin complex-associated protein) (Mammalian target of rapamycin) (mTOR) (Mechanistic target of rapamycin) (Rapamycin target protein 1) (RAPT1)	EBI-22259161	0.35
A0A0G2K781	PPFIA-binding protein 1	EBI-22259161	0.35
P00176	Cytochrome P450 2B1 (EC 1.14.14.1) (CYPIIB1) (Cytochrome P450-B) (Cytochrome P450b) (Cytochrome P450-LM2) (Cytochrome P450-PB1) (Cytochrome P450-PB2)	EBI-22259161	0.35
O08662	Phosphatidylinositol 4-kinase alpha (PI4-kinase alpha) (PI4K-alpha) (PtdIns-4-kinase alpha) (EC 2.7.1.67)	EBI-22259161	0.35
Q5PQL2	CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1)	EBI-22259161	0.35
D3ZYG0	Vav guanine nucleotide exchange factor 2	EBI-22259161	0.35
D3ZGM1	Pentatricopeptide repeat domain 3	EBI-22259161	0.35
Q8K4V4	Sorting nexin-27 (MAP-responsive gene protein) (Methamphetamine-responsive transcript 1 protein) (PDZ-protein Mrt1)	EBI-22259161	0.35
Q5RKH0	Cytokine-like nuclear factor N-PAC (NPAC) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Putative oxidoreductase GLYR1)	EBI-22259161	0.35
D4A104	Mitochondrial ribosomal protein L45 (Mitochondrial ribosomal protein L45 (Predicted))	EBI-22259161	0.35
Q9BY14	Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein)	EBI-25505061	0.35
Q9BUN8	Derlin-1 (Degradation in endoplasmic reticulum protein 1) (DERtrin-1) (Der1-like protein 1)	EBI-25770511	0.35
Q9IH62	Glycoprotein G	EBI-25750665	0.35
P34972	Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)	EBI-26880846	0.35
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
A0A0H3NFP4	SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity)	EBI-27055788	0.27
A0A0H3NG92	Type III secretion system effector protein-regulates and maintains the SCV (Type III secretion systems effector SseF)	EBI-27055968	0.27
A0A0H3NF08	SPI-2 type III secretion system effector PipB2 (Type III secretion system effector protein, Contributes to Sif formation)	EBI-27055973	0.27
A0A0H3NB75	Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV)	EBI-27055983	0.27
Q8NI60	Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3)	EBI-28943519	0.35
Q9H5K3	Protein O-mannose kinase (POMK) (EC 2.7.1.183) (Protein kinase-like protein SgK196) (Sugen kinase 196)	EBI-28948637	0.35
Q9ULR3	Protein phosphatase 1H (EC 3.1.3.16)	EBI-27116214	0.27
Q9UM73	ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246)	EBI-32719830	0.27
P29322	Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)	EBI-32721175	0.27
P11362	Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)	EBI-32721578	0.27
P22607	Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333)	EBI-32721979	0.27
P22455	Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)	EBI-32722168	0.27
P35916	Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4)	EBI-32722728	0.27
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32722947	0.27
P06213	Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]	EBI-32723092	0.27
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32724526	0.27
P07949	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]	EBI-32725031	0.27
Q01974	Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2)	EBI-32725367	0.27
Q6J9G0	Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1)	EBI-32731895	0.27

Cross-References

Database	Links
UNIPROT	O15173 Q569H1
Pfam	PF00173
OMIM	607735
DisGeNET	10424

Membrane-associated progesterone receptor component 2 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (11 interactors)

Interactions with other proteins (142 interactors)

Cross-References

Database

Links

Description

Description