Protein Information |
|
---|---|
Protein Name | Vesicle-associated membrane protein-associated protein A |
Accession Code | Q9P0L0 |
Gene | VAPA |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 249) | |
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVML QPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMP KPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFI GFFLGKFIL |
Structure Viewer (PDB: 6TQR) |
---|
Description |
||
---|---|---|
Endoplasmic reticulum membrane {Experimental EvidencePubMed:10523508, Experimental EvidencePubMed:16143324, Experimental EvidencePubMed:19289470, Experimental EvidencePubMed:25447204, Experimental EvidencePubMed:30741634}; Single-pass type IV membrane protein {Experimental EvidencePubMed:10523508, Experimental EvidencePubMed:19289470}. Cell membrane {Experimental EvidencePubMed:25447204}; Single-pass type IV membrane protein {ECO:0000305}. Cell junction, tight junction {Experimental EvidencePubMed:10523508}. Nucleus membrane {ECO:0000250|UniProtKB:Q9Z270}. Note=Present in the plasma membrane and in intracellular vesicles, together with SNARE proteins. May also associate with the cytoskeleton. Colocalizes with OCLN at the tight junction in polarized epithelial cells. {Experimental EvidencePubMed:10523508}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | Membrane Topology |
Topology | Source | Annotation Type |
Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
Cellular Component | Azurophil Granule Membrane (GO:0035577) Bicellular Tight Junction (GO:0005923) Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum Membrane (GO:0005789) Golgi Membrane (GO:0000139) Microtubule Cytoskeleton (GO:0015630) Nuclear Membrane (GO:0031965) Plasma Membrane (GO:0005886) Vesicle (GO:0031982) |
Interactions with Nuclear Envelope proteins (27 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
Q5JSH3 | WD repeat-containing protein 44 | EBI-21550773 | 0.35 |
Q6ULP2 | Aftiphilin | EBI-21550773 | 0.35 |
P16278 | Beta-galactosidase | EBI-11120309 | 0.35 |
Q9Y6K0 | Choline/ethanolaminephosphotransferase 1 | EBI-11120309 | 0.35 |
Q07065 | Cytoskeleton-associated protein 4 | EBI-11120309 | 0.35 |
P03246 | E1B protein, small T-antigen | EBI-11722343 | 0.35 |
Q15125 | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | EBI-24733627 | 0.56 |
P00533 | Epidermal growth factor receptor | EBI-4397828 | 0.71 |
Q8WYP5 | Protein ELYS | EBI-21550773 | 0.35 |
P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-8770853 | 0.55 |
Q9NWT6 | Hypoxia-inducible factor 1-alpha inhibitor | EBI-12502476 | 0.35 |
Q9P2D3 | HEAT repeat-containing protein 5B | EBI-21550773 | 0.35 |
P02545 | Lamin-A/C | EBI-16795756 | 0.27 |
Q9H4L5 | Oxysterol-binding protein-related protein 3 | EBI-11120309 | 0.35 |
Q9BZF3 | Oxysterol-binding protein-related protein 6 | EBI-11120309 | 0.35 |
P22059 | Oxysterol-binding protein 1 | EBI-11120309 | 0.74 |
O15173 | Membrane-associated progesterone receptor component 2 | EBI-24691023 | 0.56 |
P27958 | RNA-directed RNA polymerase | EBI-8849923 | 0.78 |
Q9WMX2 | RNA-directed RNA polymerase | EBI-12738328 | 0.54 |
Q03463 | RNA-directed RNA polymerase | EBI-8803422 | 0.67 |
Q99IB8 | RNA-directed RNA polymerase | EBI-8784130 | 0.56 |
P01112 | GTPase HRas, N-terminally processed | EBI-27045317 | 0.27 |
Q8WXH0 | Nesprin-2 | EBI-21550773 | 0.35 |
Q9UMZ2 | Synergin gamma | EBI-21550773 | 0.35 |
Q9BTV4 | Transmembrane protein 43 | EBI-11120309 | 0.35 |
Q9Y2K6 | Ubiquitin carboxyl-terminal hydrolase 20 | EBI-2512022 | 0.40 |
Q8TEY7 | Ubiquitin carboxyl-terminal hydrolase 33 | EBI-21550773 | 0.35 | Interactions with other proteins (283 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P01889 | HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B) | EBI-1077173 | 0.00 |
Q96SU4 | Oxysterol-binding protein-related protein 9 (ORP-9) (OSBP-related protein 9) | EBI-2514776 | 0.40 |
Q99MK9 | Ras association domain-containing protein 1 (Protein 123F2) | EBI-2556403 | 0.56 |
A0A6L7GZ58 | NTPase_I-T domain-containing protein | EBI-2812120 | 0.00 |
Q81VJ7 | Putative sugar uptake protein BA_0200/GBAA_0200/BAS0200 | EBI-2813855 | 0.00 |
Q81TU4 | UPF0234 protein BA_1166/GBAA_1166/BAS1081 | EBI-2819380 | 0.00 |
Q81VT8 | DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta) | EBI-2819368 | 0.00 |
A0A6L8PDJ5 | Alpha-ketoglutarate permease | EBI-2819418 | 0.00 |
A0A0F7RGR7 | Amino acid permease family protein | EBI-2819399 | 0.00 |
A0A6L7HCN1 | Putative membrane protein | EBI-2819425 | 0.00 |
A0A6L8PK55 | Helicase ATP-binding domain-containing protein | EBI-2819406 | 0.00 |
A0A6L7HG64 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | EBI-2819387 | 0.00 |
A0A6L8NZ61 | Carbon starvation protein A | EBI-2819455 | 0.00 |
A0A6L8NYR0 | Group-specific protein | EBI-2819437 | 0.00 |
Q81JE0 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | EBI-2819468 | 0.00 |
A0A4Y1W7L5 | Conserved membrane protein YqhR | EBI-2819444 | 0.00 |
Q8CZU2 | Putative autotransporter adhesin | EBI-2843966 | 0.00 |
Q0WAZ5 | Putative membrane protein | EBI-2850711 | 0.00 |
Q8D1S0 | Putative transport protein, symporter | EBI-2850699 | 0.00 |
A0A2U2GZH9 | Putative membrane protein | EBI-2850718 | 0.00 |
Q5T4F4 | Protrudin (Spastic paraplegia 33 protein) (Zinc finger FYVE domain-containing protein 27) | EBI-3894106 | 0.57 |
Q96TC7 | Regulator of microtubule dynamics protein 3 (RMD-3) (hRMD-3) (Cerebral protein 10) (Protein FAM82A2) (Protein FAM82C) (Protein tyrosine phosphatase-interacting protein 51) (TCPTP-interacting protein 51) | EBI-7415741 | 0.55 |
P15336 | Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response element-binding protein CRE-BP1) | EBI-5529812 | 0.35 |
P04578 | Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)] | EBI-6176669 | 0.46 |
P19320 | Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) | EBI-6191076 | 0.53 |
P17612 | cAMP-dependent protein kinase catalytic subunit alpha (PKA C-alpha) (EC 2.7.11.11) | EBI-6255618 | 0.53 |
P22694 | cAMP-dependent protein kinase catalytic subunit beta (PKA C-beta) (EC 2.7.11.11) | EBI-6255866 | 0.53 |
Q13188 | Serine/threonine-protein kinase 3 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 2) (MST-2) (STE20-like kinase MST2) (Serine/threonine-protein kinase Krs-1) [Cleaved into: Serine/threonine-protein kinase 3 36kDa subunit (MST2/N); Serine/threonine-protein kinase 3 20kDa subunit (MST2/C)] | EBI-6256382 | 0.53 |
Q77M19 | V protein | EBI-6270503 | 0.35 |
P02751 | Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3] | EBI-6285956 | 0.35 |
Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-6911839 | 0.35 |
Q86WH2 | Ras association domain-containing protein 3 | EBI-6912050 | 0.35 |
P35372 | Mu-type opioid receptor (M-OR-1) (MOR-1) (Mu opiate receptor) (Mu opioid receptor) (MOP) (hMOP) | EBI-6918974 | 0.68 |
P32300 | Delta-type opioid receptor (D-OR-1) (DOR-1) (K56) (MSL-2) | EBI-6926064 | 0.40 |
P41145 | Kappa-type opioid receptor (K-OR-1) (KOR-1) | EBI-6926066 | 0.40 |
Q6PEC3 | Protein YIF1B (YIP1-interacting factor homolog B) | EBI-8804473 | 0.46 |
O95070 | Protein YIF1A (54TMp) (YIP1-interacting factor homolog A) | EBI-8850242 | 0.60 |
O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | EBI-8840764 | 0.56 |
Q9P035 | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (hB-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1) | EBI-9083284 | 0.40 |
Q99614 | Tetratricopeptide repeat protein 1 (TPR repeat protein 1) | EBI-9395686 | 0.53 |
O95772 | STARD3 N-terminal-like protein (MLN64 N-terminal domain homolog) | EBI-9819574 | 0.46 |
Q14849 | StAR-related lipid transfer protein 3 (Metastatic lymph node gene 64 protein) (MLN 64) (Protein CAB1) (START domain-containing protein 3) (StARD3) | EBI-9819322 | 0.52 |
P19838 | Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit] | EBI-11322417 | 0.35 |
P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
P03182 | Apoptosis regulator BHRF1 (Early antigen protein R) (EA-R) (Nuclear antigen) | EBI-11721938 | 0.35 |
P06460 | Probable protein E5A | EBI-11723082 | 0.35 |
P06792 | Probable protein E5 | EBI-11724527 | 0.35 |
P0C739 | Protein BNLF2a | EBI-11725101 | 0.35 |
P69901 | Probable protein E5B | EBI-11733364 | 0.35 |
A2AUM9 | Centrosomal protein of 152 kDa (Cep152) | EBI-10994361 | 0.35 |
Q3UJU9 | Regulator of microtubule dynamics protein 3 (RMD-3) (mRMD-3) (Protein FAM82A2) (Protein FAM82C) | EBI-11021410 | 0.35 |
P60710 | Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-11045267 | 0.35 |
O95786 | Antiviral innate immune response receptor RIG-I (ATP-dependent RNA helicase DDX58) (EC 3.6.4.13) (DEAD box protein 58) (RIG-I-like receptor 1) (RLR-1) (Retinoic acid-inducible gene 1 protein) (RIG-1) (Retinoic acid-inducible gene I protein) (RIG-I) | EBI-11120309 | 0.35 |
P10644 | cAMP-dependent protein kinase type I-alpha regulatory subunit (Tissue-specific extinguisher 1) (TSE1) | EBI-11120309 | 0.53 |
Q969M3 | Protein YIPF5 (Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5) (Smooth muscle cell-associated protein 5) (SMAP-5) (YIP1 family member 5) (YPT-interacting protein 1 A) | EBI-11120309 | 0.35 |
Q96BQ5 | Coiled-coil domain-containing protein 127 | EBI-11120309 | 0.35 |
Q8N4V1 | ER membrane protein complex subunit 5 (Membrane magnesium transporter 1) (Transmembrane protein 32) | EBI-11120309 | 0.35 |
P47985 | Cytochrome b-c1 complex subunit Rieske, mitochondrial (EC 7.1.1.8) (Complex III subunit 5) (Cytochrome b-c1 complex subunit 5) (Rieske iron-sulfur protein) (RISP) (Rieske protein UQCRFS1) (Ubiquinol-cytochrome c reductase iron-sulfur subunit) [Cleaved into: Cytochrome b-c1 complex subunit 9 (Su9) (Subunit 9) (8 kDa subunit 9) (Complex III subunit IX) (Cytochrome b-c1 complex subunit 11) (UQCRFS1 mitochondrial targeting sequence) (UQCRFS1 MTS) (Ubiquinol-cytochrome c reductase 8 kDa protein)] | EBI-11120309 | 0.35 |
Q9ULH0 | Kinase D-interacting substrate of 220 kDa (Ankyrin repeat-rich membrane-spanning protein) | EBI-11120309 | 0.35 |
P35232 | Prohibitin 1 | EBI-11120309 | 0.35 |
Q5T8D3 | Acyl-CoA-binding domain-containing protein 5 | EBI-11120309 | 0.35 |
Q9UBQ5 | Eukaryotic translation initiation factor 3 subunit K (eIF3k) (Eukaryotic translation initiation factor 3 subunit 12) (Muscle-specific gene M9 protein) (PLAC-24) (eIF-3 p25) (eIF-3 p28) | EBI-11120309 | 0.35 |
K7EJC8 | Golgi SNAP receptor complex member 1 | EBI-11120309 | 0.35 |
Q6NZI2 | Caveolae-associated protein 1 (Cavin-1) (Polymerase I and transcript release factor) | EBI-11120309 | 0.35 |
P28331 | NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (EC 7.1.1.2) (Complex I-75kD) (CI-75kD) | EBI-11120309 | 0.35 |
Q9HCK4 | Roundabout homolog 2 | EBI-11120309 | 0.35 |
O95182 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 (Complex I-B14.5a) (CI-B14.5a) (NADH-ubiquinone oxidoreductase subunit B14.5a) | EBI-11120309 | 0.35 |
O14653 | Golgi SNAP receptor complex member 2 (27 kDa Golgi SNARE protein) (Membrin) | EBI-11120309 | 0.35 |
P35610 | Sterol O-acyltransferase 1 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 1) (ACAT-1) (Cholesterol acyltransferase 1) | EBI-11120309 | 0.35 |
Q8NE86 | Calcium uniporter protein, mitochondrial (HsMCU) (Coiled-coil domain-containing protein 109A) | EBI-11120309 | 0.35 |
O00461 | Golgi integral membrane protein 4 (Golgi integral membrane protein, cis) (GIMPc) (Golgi phosphoprotein 4) (Golgi-localized phosphoprotein of 130 kDa) (Golgi phosphoprotein of 130 kDa) | EBI-11120309 | 0.35 |
P21796 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) | EBI-11120309 | 0.35 |
O75306 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial (EC 7.1.1.2) (Complex I-49kD) (CI-49kD) (NADH-ubiquinone oxidoreductase 49 kDa subunit) | EBI-11120309 | 0.35 |
P56181 | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial (Complex I-9kD) (CI-9kD) (NADH-ubiquinone oxidoreductase 9 kDa subunit) (Renal carcinoma antigen NY-REN-4) | EBI-11120309 | 0.35 |
Q13445 | Transmembrane emp24 domain-containing protein 1 (Interleukin-1 receptor-like 1 ligand) (Putative T1/ST2 receptor-binding protein) (p24 family protein gamma-1) (Tp24) (p24gamma1) | EBI-11120309 | 0.35 |
P10606 | Cytochrome c oxidase subunit 5B, mitochondrial (Cytochrome c oxidase polypeptide Vb) | EBI-11120309 | 0.35 |
O00562 | Membrane-associated phosphatidylinositol transfer protein 1 (Drosophila retinal degeneration B homolog) (Phosphatidylinositol transfer protein, membrane-associated 1) (PITPnm 1) (Pyk2 N-terminal domain-interacting receptor 2) (NIR-2) | EBI-11120309 | 0.35 |
O43678 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 (Complex I-B8) (CI-B8) (NADH-ubiquinone oxidoreductase B8 subunit) | EBI-11120309 | 0.35 |
Q9BZ71 | Membrane-associated phosphatidylinositol transfer protein 3 (Phosphatidylinositol transfer protein, membrane-associated 3) (PITPnm 3) (Pyk2 N-terminal domain-interacting receptor 1) (NIR-1) | EBI-11120309 | 0.35 |
Q9BXB5 | Oxysterol-binding protein-related protein 10 (ORP-10) (OSBP-related protein 10) | EBI-11120309 | 0.35 |
Q9NRZ9 | Lymphoid-specific helicase (EC 3.6.4.-) (Proliferation-associated SNF2-like protein) (SWI/SNF2-related matrix-associated actin-dependent regulator of chromatin subfamily A member 6) | EBI-11120309 | 0.35 |
Q9NX63 | MICOS complex subunit MIC19 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 3) | EBI-11120309 | 0.35 |
O94905 | Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2) | EBI-11120309 | 0.35 |
O75477 | Erlin-1 (Endoplasmic reticulum lipid raft-associated protein 1) (Protein KE04) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (SPFH domain-containing protein 1) | EBI-11120309 | 0.35 |
Q99623 | Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity) | EBI-11120309 | 0.35 |
Q9UBD5 | Origin recognition complex subunit 3 (Origin recognition complex subunit Latheo) | EBI-11120309 | 0.35 |
O75348 | V-type proton ATPase subunit G 1 (V-ATPase subunit G 1) (V-ATPase 13 kDa subunit 1) (Vacuolar proton pump subunit G 1) (Vacuolar proton pump subunit M16) | EBI-11120309 | 0.35 |
P21281 | V-type proton ATPase subunit B, brain isoform (V-ATPase subunit B 2) (Endomembrane proton pump 58 kDa subunit) (HO57) (Vacuolar proton pump subunit B 2) | EBI-11120309 | 0.35 |
Q14254 | Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1) | EBI-11120309 | 0.35 |
Q8NC06 | Acyl-CoA-binding domain-containing protein 4 | EBI-11120309 | 0.35 |
O14880 | Microsomal glutathione S-transferase 3 (Microsomal GST-3) (Glutathione peroxidase MGST3) (EC 1.11.1.-) (LTC4 synthase MGST3) (EC 4.4.1.20) (Microsomal glutathione S-transferase III) (Microsomal GST-III) | EBI-11120309 | 0.35 |
P45880 | Voltage-dependent anion-selective channel protein 2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2) | EBI-11120309 | 0.35 |
Q8N1G2 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (EC 2.1.1.57) (Cap methyltransferase 1) (Cap1 2'O-ribose methyltransferase 1) (MTr1) (hMTr1) (FtsJ methyltransferase domain-containing protein 2) (Interferon-stimulated gene 95 kDa protein) (ISG95) | EBI-11120309 | 0.35 |
B7ZAQ6 | Golgi pH regulator A (Protein GPR89A) (Putative MAPK-activating protein PM01) (Putative NF-kappa-B-activating protein 90) | EBI-11120309 | 0.35 |
O75381 | Peroxisomal membrane protein PEX14 (PTS1 receptor-docking protein) (Peroxin-14) (Peroxisomal membrane anchor protein PEX14) | EBI-11120309 | 0.35 |
P09669 | Cytochrome c oxidase subunit 6C (Cytochrome c oxidase polypeptide VIc) | EBI-11120309 | 0.35 |
Q8TEW0 | Partitioning defective 3 homolog (PAR-3) (PARD-3) (Atypical PKC isotype-specific-interacting protein) (ASIP) (CTCL tumor antigen se2-5) (PAR3-alpha) | EBI-11120309 | 0.35 |
Q03135 | Caveolin-1 | EBI-11120309 | 0.35 |
Q9BXB4 | Oxysterol-binding protein-related protein 11 (ORP-11) (OSBP-related protein 11) | EBI-11120309 | 0.35 |
O95168 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (Complex I-B15) (CI-B15) (NADH-ubiquinone oxidoreductase B15 subunit) | EBI-11120309 | 0.35 |
O43920 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (Complex I-15 kDa) (CI-15 kDa) (NADH-ubiquinone oxidoreductase 15 kDa subunit) | EBI-11120309 | 0.35 |
P53007 | Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein) | EBI-11120309 | 0.35 |
Q92604 | Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Acyl-CoA:monoacylglycerol acyltransferase LPGAT1) (EC 2.3.1.22) (Lysophospholipid acyltransferase 7) (LPLAT7) (EC 2.3.1.-) (Stearoyl-CoA:1-lyso-2-acyl-PE acyltransferase) | EBI-11120309 | 0.35 |
Q92508 | Piezo-type mechanosensitive ion channel component 1 (Membrane protein induced by beta-amyloid treatment) (Mib) (Protein FAM38A) | EBI-11120309 | 0.35 |
Q9H089 | Large subunit GTPase 1 homolog (hLsg1) (EC 3.6.1.-) | EBI-11120309 | 0.35 |
Q9UBH6 | Xenotropic and polytropic retrovirus receptor 1 (Protein SYG1 homolog) (Xenotropic and polytropic murine leukemia virus receptor X3) (X-receptor) | EBI-11120309 | 0.35 |
Q16891 | MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89) | EBI-11120309 | 0.35 |
O95169 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (Complex I-ASHI) (CI-ASHI) (NADH-ubiquinone oxidoreductase ASHI subunit) | EBI-11120309 | 0.35 |
Q969G5 | Caveolae-associated protein 3 (Cavin-3) (Protein kinase C delta-binding protein) (Serum deprivation response factor-related gene product that binds to C-kinase) (hSRBC) | EBI-11120309 | 0.35 |
Q9Y2H6 | Fibronectin type-III domain-containing protein 3A (Human gene expressed in odontoblasts) | EBI-11120309 | 0.35 |
Q16795 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial (Complex I-39kD) (CI-39kD) (NADH-ubiquinone oxidoreductase 39 kDa subunit) | EBI-11120309 | 0.35 |
B4E2V5 | cDNA FLJ52062, highly similar to Erythrocyte band 7 integral membrane protein | EBI-11120309 | 0.35 |
Q99519 | Sialidase-1 (EC 3.2.1.18) (Acetylneuraminyl hydrolase) (G9 sialidase) (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1) | EBI-11120309 | 0.35 |
Q8TBE9 | N-acylneuraminate-9-phosphatase (EC 3.1.3.29) (Haloacid dehalogenase-like hydrolase domain-containing protein 4) (Neu5Ac-9-Pase) | EBI-11120309 | 0.35 |
O75746 | Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial (Araceli hiperlarga) (Aralar) (Aralar1) (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) | EBI-11120309 | 0.35 |
Q14573 | Inositol 1,4,5-trisphosphate receptor type 3 (IP3 receptor isoform 3) (IP3R 3) (InsP3R3) (Type 3 inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) | EBI-11120309 | 0.35 |
P19404 | NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (EC 7.1.1.2) (NADH-ubiquinone oxidoreductase 24 kDa subunit) | EBI-11120309 | 0.35 |
P14854 | Cytochrome c oxidase subunit 6B1 (Cytochrome c oxidase subunit VIb isoform 1) (COX VIb-1) | EBI-11120309 | 0.35 |
Q8TCJ2 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B (Oligosaccharyl transferase subunit STT3B) (STT3-B) (EC 2.4.99.18) (Source of immunodominant MHC-associated peptides homolog) | EBI-11120309 | 0.35 |
Q8NBU5 | Outer mitochondrial transmembrane helix translocase (EC 7.4.2.-) (ATPase family AAA domain-containing protein 1) (hATAD1) (Thorase) | EBI-11120309 | 0.35 |
P10619 | Lysosomal protective protein (EC 3.4.16.5) (Carboxypeptidase C) (Carboxypeptidase L) (Cathepsin A) (Protective protein cathepsin A) (PPCA) (Protective protein for beta-galactosidase) [Cleaved into: Lysosomal protective protein 32 kDa chain; Lysosomal protective protein 20 kDa chain] | EBI-11120309 | 0.35 |
Q9P0J0 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Cell death regulatory protein GRIM-19) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic and interferon-induced mortality 19 protein) (GRIM-19) (Gene associated with retinoic and IFN-induced mortality 19 protein) (NADH-ubiquinone oxidoreductase B16.6 subunit) | EBI-11120309 | 0.35 |
H0YLN8 | Non-specific serine/threonine protein kinase (EC 2.7.11.1) | EBI-11120309 | 0.35 |
O43181 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial (Complex I-18 kDa) (CI-18 kDa) (Complex I-AQDQ) (CI-AQDQ) (NADH-ubiquinone oxidoreductase 18 kDa subunit) | EBI-11120309 | 0.35 |
Q9BZ72 | Membrane-associated phosphatidylinositol transfer protein 2 (Phosphatidylinositol transfer protein, membrane-associated 2) (PITPnm 2) (Pyk2 N-terminal domain-interacting receptor 3) (NIR-3) | EBI-11120309 | 0.35 |
Q9BQB6 | Vitamin K epoxide reductase complex subunit 1 (EC 1.17.4.4) (Vitamin K1 2,3-epoxide reductase subunit 1) | EBI-11120309 | 0.35 |
O95159 | Zinc finger protein-like 1 (Zinc finger protein MCG4) | EBI-11120309 | 0.35 |
Q14318 | Peptidyl-prolyl cis-trans isomerase FKBP8 (PPIase FKBP8) (EC 5.2.1.8) (38 kDa FK506-binding protein) (38 kDa FKBP) (FKBP-38) (hFKBP38) (FK506-binding protein 8) (FKBP-8) (FKBPR38) (Rotamase) | EBI-11120309 | 0.35 |
P28288 | ATP-binding cassette sub-family D member 3 (EC 3.1.2.-) (EC 7.6.2.-) (70 kDa peroxisomal membrane protein) (PMP70) | EBI-11120309 | 0.35 |
C9J0K6 | Sorcin | EBI-11120309 | 0.35 |
P61421 | V-type proton ATPase subunit d 1 (V-ATPase subunit d 1) (32 kDa accessory protein) (V-ATPase 40 kDa accessory protein) (V-ATPase AC39 subunit) (p39) (Vacuolar proton pump subunit d 1) | EBI-11120309 | 0.35 |
P38606 | V-type proton ATPase catalytic subunit A (V-ATPase subunit A) (EC 7.1.2.2) (V-ATPase 69 kDa subunit) (Vacuolar ATPase isoform VA68) (Vacuolar proton pump subunit alpha) | EBI-11120309 | 0.35 |
Q9UJZ1 | Stomatin-like protein 2, mitochondrial (SLP-2) (EPB72-like protein 2) (Paraprotein target 7) (Paratarg-7) | EBI-11120309 | 0.35 |
E9PPW7 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (EC 7.1.1.2) (Complex I-23kD) (NADH-ubiquinone oxidoreductase 23 kDa subunit) | EBI-11120309 | 0.35 |
Q7Z6K3 | Protein prenyltransferase alpha subunit repeat-containing protein 1 | EBI-11120309 | 0.35 |
Q04446 | 1,4-alpha-glucan-branching enzyme (EC 2.4.1.18) (Brancher enzyme) (Glycogen-branching enzyme) | EBI-11120309 | 0.35 |
O75410 | Transforming acidic coiled-coil-containing protein 1 (Gastric cancer antigen Ga55) (Taxin-1) | EBI-11120309 | 0.35 |
O95299 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (Complex I-42kD) (CI-42kD) (NADH-ubiquinone oxidoreductase 42 kDa subunit) | EBI-11120309 | 0.35 |
Q9NZN5 | Rho guanine nucleotide exchange factor 12 (Leukemia-associated RhoGEF) | EBI-11120309 | 0.35 |
P31930 | Cytochrome b-c1 complex subunit 1, mitochondrial (Complex III subunit 1) (Core protein I) (Ubiquinol-cytochrome-c reductase complex core protein 1) | EBI-11120309 | 0.35 |
C9JKI3 | Caveolin | EBI-11120309 | 0.35 |
P56556 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (Complex I-B14) (CI-B14) (LYR motif-containing protein 6) (NADH-ubiquinone oxidoreductase B14 subunit) | EBI-11120309 | 0.35 |
Q9NX14 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (Complex I-ESSS) (CI-ESSS) (NADH-ubiquinone oxidoreductase ESSS subunit) (Neuronal protein 17.3) (Np17.3) (p17.3) | EBI-11120309 | 0.35 |
P49821 | NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (EC 7.1.1.2) (Complex I-51kD) (CI-51kD) (NADH dehydrogenase flavoprotein 1) (NADH-ubiquinone oxidoreductase 51 kDa subunit) | EBI-11120309 | 0.35 |
Q96N66 | Lysophospholipid acyltransferase 7 (LPLAT 7) (EC 2.3.1.-) (1-acylglycerophosphatidylinositol O-acyltransferase) (Bladder and breast carcinoma-overexpressed gene 1 protein) (Leukocyte receptor cluster member 4) (Lysophosphatidylinositol acyltransferase) (LPIAT) (Lyso-PI acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 7) (O-acyltransferase domain-containing protein 7) (h-mboa-7) | EBI-11120309 | 0.35 |
Q16718 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (Complex I subunit B13) (Complex I-13kD-B) (CI-13kD-B) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit) | EBI-11120309 | 0.35 |
P33897 | ATP-binding cassette sub-family D member 1 (EC 3.1.2.-) (EC 7.6.2.-) (Adrenoleukodystrophy protein) (ALDP) | EBI-11120309 | 0.35 |
Q08380 | Galectin-3-binding protein (Basement membrane autoantigen p105) (Lectin galactoside-binding soluble 3-binding protein) (Mac-2-binding protein) (MAC2BP) (Mac-2 BP) (Tumor-associated antigen 90K) | EBI-11120309 | 0.35 |
Q9BRQ6 | MICOS complex subunit MIC25 (Coiled-coil-helix cristae morphology protein 1) (Coiled-coil-helix-coiled-coil-helix domain-containing protein 6) | EBI-11120309 | 0.35 |
P51532 | Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Mitotic growth and transcription activator) (Protein BRG-1) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4) | EBI-11120309 | 0.35 |
O75380 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial (Complex I-13kD-A) (CI-13kD-A) (NADH-ubiquinone oxidoreductase 13 kDa-A subunit) | EBI-11120309 | 0.35 |
O75955 | Flotillin-1 | EBI-11120309 | 0.35 |
Q9UI09 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 (13 kDa differentiation-associated protein) (Complex I-B17.2) (CI-B17.2) (CIB17.2) (NADH-ubiquinone oxidoreductase subunit B17.2) | EBI-11120309 | 0.35 |
O15260 | Surfeit locus protein 4 | EBI-11120309 | 0.35 |
Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | EBI-11120309 | 0.35 |
Q5SVZ6 | Zinc finger MYM-type protein 1 | EBI-11120309 | 0.35 |
Q15006 | ER membrane protein complex subunit 2 (Tetratricopeptide repeat protein 35) (TPR repeat protein 35) | EBI-11130215 | 0.35 |
Q5T3F8 | CSC1-like protein 2 (Transmembrane protein 63B) | EBI-11155257 | 0.35 |
Q9Y3E0 | Vesicle transport protein GOT1B (Germ cell tumor 2) (Golgi transport 1 homolog B) (Putative NF-kappa-B-activating protein 470) (hGOT1a) | EBI-11161387 | 0.35 |
Q96GX1 | Tectonic-2 | EBI-11375285 | 0.27 |
Q9P0N5 | Transmembrane protein 216 | EBI-11378021 | 0.27 |
Q9QXM1 | Junction-mediating and -regulatory protein | EBI-11475522 | 0.35 |
Q4G0X9 | Coiled-coil domain-containing protein 40 | EBI-12449318 | 0.35 |
P61006 | Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel) | EBI-11832855 | 0.35 |
P05090 | Apolipoprotein D (Apo-D) (ApoD) | EBI-24368883 | 0.72 |
Q96K78 | Adhesion G-protein coupled receptor G7 (G-protein coupled receptor 128) | EBI-24499429 | 0.56 |
O00559 | Receptor-binding cancer antigen expressed on SiSo cells (Cancer-associated surface antigen RCAS1) (Estrogen receptor-binding fragment-associated gene 9 protein) | EBI-24699966 | 0.56 |
Q9Y320 | Thioredoxin-related transmembrane protein 2 (Cell proliferation-inducing gene 26 protein) (Thioredoxin domain-containing protein 14) | EBI-24703968 | 0.56 |
Q8N661 | Lysoplasmalogenase (EC 3.3.2.2) (Transmembrane protein 86B) | EBI-24705292 | 0.56 |
Q8N5M9 | Protein jagunal homolog 1 | EBI-24706911 | 0.56 |
P78383 | Solute carrier family 35 member B1 (ATP/ADP exchanger ER) (AXER) (Endoplasmic reticulum ATP/ADP translocase) (UDP-galactose transporter-related protein 1) (UGTrel1) | EBI-24709430 | 0.56 |
O60669 | Monocarboxylate transporter 2 (MCT 2) (Solute carrier family 16 member 7) | EBI-23766238 | 0.56 |
Q53TN4 | Plasma membrane ascorbate-dependent reductase CYBRD1 (EC 7.2.1.3) (Cytochrome b reductase 1) (Duodenal cytochrome b) (Ferric-chelate reductase 3) | EBI-24718559 | 0.56 |
P49447 | Transmembrane ascorbate-dependent reductase CYB561 (EC 7.2.1.-) (Cytochrome b-561) (Cytochrome b561) | EBI-24723641 | 0.56 |
Q7Z5P4 | 17-beta-hydroxysteroid dehydrogenase 13 (17-beta-HSD 13) (EC 1.1.-.-) (Short chain dehydrogenase/reductase family 16C member 3) (Short-chain dehydrogenase/reductase 9) | EBI-24742483 | 0.56 |
P11912 | B-cell antigen receptor complex-associated protein alpha chain (Ig-alpha) (MB-1 membrane glycoprotein) (Membrane-bound immunoglobulin-associated protein) (Surface IgM-associated protein) (CD antigen CD79a) | EBI-24752923 | 0.56 |
Q8NBD8 | Transmembrane protein 229B | EBI-24764619 | 0.56 |
Q8NBQ5 | Estradiol 17-beta-dehydrogenase 11 (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase 11) (17-beta-HSD 11) (17bHSD11) (17betaHSD11) (17-beta-hydroxysteroid dehydrogenase XI) (17-beta-HSD XI) (17betaHSDXI) (Cutaneous T-cell lymphoma-associated antigen HD-CL-03) (CTCL-associated antigen HD-CL-03) (Dehydrogenase/reductase SDR family member 8) (Retinal short-chain dehydrogenase/reductase 2) (retSDR2) (Short chain dehydrogenase/reductase family 16C member 2) | EBI-24786679 | 0.56 |
Q9BY50 | Signal peptidase complex catalytic subunit SEC11C (EC 3.4.21.89) (Microsomal signal peptidase 21 kDa subunit) (SPase 21 kDa subunit) (SEC11 homolog C) (SEC11-like protein 3) (SPC21) | EBI-24795986 | 0.56 |
O15209 | Zinc finger and BTB domain-containing protein 22 (Protein BING1) (Zinc finger and BTB domain-containing protein 22A) (Zinc finger protein 297) | EBI-24417267 | 0.56 |
Q06432 | Voltage-dependent calcium channel gamma-1 subunit (Dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma) | EBI-24260483 | 0.56 |
Q96LZ7 | Regulator of microtubule dynamics protein 2 (RMD-2) (hRMD-2) (Protein FAM82A1) | EBI-24471737 | 0.56 |
Q9NS71 | Gastrokine-1 (18 kDa antrum mucosa protein) (AMP-18) (Protein CA11) | EBI-24541663 | 0.56 |
A0A024R8A9 | Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12) | EBI-24560517 | 0.56 |
O95214 | Leptin receptor overlapping transcript-like 1 (Endospanin-2) | EBI-24641938 | 0.56 |
Q13520 | Aquaporin-6 (AQP-6) (Aquaporin-2-like) (Kidney-specific aquaporin) (hKID) | EBI-24643376 | 0.56 |
Q9NY72 | Sodium channel subunit beta-3 | EBI-24648989 | 0.56 |
Q53FP2 | Novel acetylcholine receptor chaperone | EBI-24805194 | 0.56 |
Q86VR2 | Reticulophagy regulator 3 | EBI-25220827 | 0.56 |
Q969R2 | Oxysterol-binding protein 2 (Oxysterol-binding protein-related protein 4) (ORP-4) (OSBP-related protein 4) | EBI-12519574 | 0.37 |
Q9BXW6 | Oxysterol-binding protein-related protein 1 (ORP-1) (OSBP-related protein 1) | EBI-25616876 | 0.60 |
Q9H1P3 | Oxysterol-binding protein-related protein 2 (ORP-2) (OSBP-related protein 2) | EBI-12519604 | 0.37 |
Q8WXG1 | Radical S-adenosyl methionine domain-containing protein 2 (EC 4.2.-.-) (Cytomegalovirus-induced gene 5 protein) (Viperin) (Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible) | EBI-12738199 | 0.66 |
P60033 | CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81) | EBI-20568535 | 0.35 |
O15069 | NAC-alpha domain-containing protein 1 | EBI-21550773 | 0.35 |
Q9UKA4 | A-kinase anchor protein 11 (AKAP-11) (A-kinase anchor protein 220 kDa) (AKAP 220) (hAKAP220) (Protein kinase A-anchoring protein 11) (PRKA11) | EBI-21550773 | 0.35 |
Q9P0K7 | Ankycorbin (Ankyrin repeat and coiled-coil structure-containing protein) (Novel retinal pigment epithelial cell protein) (Retinoic acid-induced protein 14) | EBI-21550773 | 0.35 |
Q9NZJ5 | Eukaryotic translation initiation factor 2-alpha kinase 3 (EC 2.7.11.1) (PRKR-like endoplasmic reticulum kinase) (Pancreatic eIF2-alpha kinase) (HsPEK) | EBI-21550773 | 0.35 |
Q9NVV0 | Trimeric intracellular cation channel type B (TRIC-B) (TRICB) (Transmembrane protein 38B) | EBI-21550773 | 0.35 |
Q9NS23 | Ras association domain-containing protein 1 | EBI-21550773 | 0.35 |
Q9HCK1 | DBF4-type zinc finger-containing protein 2 | EBI-21550773 | 0.35 |
Q9H939 | Proline-serine-threonine phosphatase-interacting protein 2 (PEST phosphatase-interacting protein 2) | EBI-21550773 | 0.35 |
Q9H8H0 | Nucleolar protein 11 | EBI-21550773 | 0.35 |
Q9H2D6 | TRIO and F-actin-binding protein (Protein Tara) (Trio-associated repeat on actin) | EBI-21550773 | 0.35 |
Q9BQE3 | Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain] | EBI-21550773 | 0.35 |
Q96RL7 | Intermembrane lipid transfer protein VPS13A (Chorea-acanthocytosis protein) (Chorein) (Vacuolar protein sorting-associated protein 13A) | EBI-21550773 | 0.35 |
Q8TDY2 | RB1-inducible coiled-coil protein 1 (FAK family kinase-interacting protein of 200 kDa) (FIP200) | EBI-21550773 | 0.35 |
Q8NHP6 | Motile sperm domain-containing protein 2 | EBI-21550773 | 0.35 |
Q8N9B5 | Junction-mediating and -regulatory protein | EBI-21550773 | 0.35 |
Q7RTP6 | [F-actin]-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3) | EBI-21550773 | 0.35 |
Q7L4E1 | Mitoguardin 2 (Protein FAM73B) | EBI-21550773 | 0.35 |
Q709C8 | Intermembrane lipid transfer protein VPS13C (Vacuolar protein sorting-associated protein 13C) | EBI-21550773 | 0.35 |
Q6WCQ1 | Myosin phosphatase Rho-interacting protein (M-RIP) (Rho-interacting protein 3) (RIP3) (p116Rip) | EBI-21550773 | 0.35 |
Q15042 | Rab3 GTPase-activating protein catalytic subunit (RAB3 GTPase-activating protein 130 kDa subunit) (Rab3-GAP p130) (Rab3-GAP) | EBI-21550773 | 0.35 |
Q05209 | Tyrosine-protein phosphatase non-receptor type 12 (EC 3.1.3.48) (PTP-PEST) (Protein-tyrosine phosphatase G1) (PTPG1) | EBI-21550773 | 0.35 |
P50453 | Serpin B9 (Cytoplasmic antiproteinase 3) (CAP-3) (CAP3) (Peptidase inhibitor 9) (PI-9) | EBI-21550773 | 0.35 |
P31321 | cAMP-dependent protein kinase type I-beta regulatory subunit | EBI-21550773 | 0.35 |
O95067 | G2/mitotic-specific cyclin-B2 | EBI-21550773 | 0.35 |
A6ND36 | Protein FAM83G (Protein associated with SMAD1) | EBI-21550773 | 0.35 |
Q12765 | Secernin-1 | EBI-21565088 | 0.35 |
P36941 | Tumor necrosis factor receptor superfamily member 3 (Lymphotoxin-beta receptor) (Tumor necrosis factor C receptor) (Tumor necrosis factor receptor 2-related protein) (Tumor necrosis factor receptor type III) (TNF-RIII) (TNFR-III) | EBI-21581171 | 0.35 |
A1A519 | Protein FAM170A (Zinc finger domain-containing protein) (Zinc finger protein ZNFD) | EBI-21701765 | 0.35 |
Q9UKL6 | Phosphatidylcholine transfer protein (PC-TP) (START domain-containing protein 2) (StARD2) (StAR-related lipid transfer protein 2) | EBI-21900698 | 0.40 |
O15503 | Insulin-induced gene 1 protein (INSIG-1) | EBI-15578834 | 0.40 |
Q5ZSD5 | SidF, inhibitor of growth family, member 3 | EBI-15625386 | 0.37 |
O15155 | BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18) | EBI-16788067 | 0.27 |
P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-16788621 | 0.42 |
Q96I36 | Cytochrome c oxidase assembly protein COX14 | EBI-16791250 | 0.27 |
P11279 | Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) | EBI-16794808 | 0.27 |
Q9HBL7 | Plasminogen receptor (KT) (Plg-R(KT)) | EBI-16797780 | 0.27 |
P51151 | Ras-related protein Rab-9A | EBI-16798325 | 0.27 |
O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.27 |
Q9HCE5 | N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14) | EBI-20595531 | 0.35 |
P07550 | Beta-2 adrenergic receptor (Beta-2 adrenoreceptor) (Beta-2 adrenoceptor) | EBI-20802046 | 0.37 |
O75683 | Surfeit locus protein 6 | EBI-20900511 | 0.40 |
Q96CG8 | Collagen triple helix repeat-containing protein 1 | EBI-20903648 | 0.40 |
O43306 | Adenylate cyclase type 6 (EC 4.6.1.1) (ATP pyrophosphate-lyase 6) (Adenylate cyclase type VI) (Adenylyl cyclase 6) (Ca(2+)-inhibitable adenylyl cyclase) | EBI-20903576 | 0.40 |
Q96JK2 | DDB1- and CUL4-associated factor 5 (Breakpoint cluster region protein 2) (BCRP2) (WD repeat-containing protein 22) | EBI-20906280 | 0.40 |
Q9Y592 | Centrosomal protein of 83 kDa (Cep83) (Coiled-coil domain-containing protein 41) (Renal carcinoma antigen NY-REN-58) | EBI-20907480 | 0.40 |
A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
P04156 | Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230) | EBI-21014654 | 0.35 |
Q9H1C4 | Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1) | EBI-21266770 | 0.35 |
O95183 | Vesicle-associated membrane protein 5 (VAMP-5) (Myobrevin) | EBI-21267749 | 0.35 |
Q96GC9 | Vacuole membrane protein 1 (Transmembrane protein 49) | EBI-21267986 | 0.35 |
Q969F8 | KiSS-1 receptor (KiSS-1R) (G-protein coupled receptor 54) (G-protein coupled receptor OT7T175) (hOT7T175) (Hypogonadotropin-1) (Kisspeptins receptor) (Metastin receptor) | EBI-21282024 | 0.40 |
P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-21391954 | 0.00 |
P15498 | Proto-oncogene vav | EBI-25372968 | 0.35 |
P51636 | Caveolin-2 | EBI-25383812 | 0.35 |
O84008 | Uncharacterized protein CT_005 | EBI-22302433 | 0.35 |
O84560 | Inner membrane protein | EBI-22302905 | 0.35 |
Q640N3 | Rho GTPase-activating protein 30 (Rho-type GTPase-activating protein 30) | EBI-25409042 | 0.35 |
Q92685 | Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase (EC 2.4.1.258) (Asparagine-linked glycosylation protein 3 homolog) (Dol-P-Man-dependent alpha(1-3)-mannosyltransferase) (Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase) (Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase) (Not56-like protein) | EBI-25468275 | 0.37 |
Q8NBM4 | Ubiquitin-associated domain-containing protein 2 (UBA domain-containing protein 2) (Phosphoglycerate dehydrogenase-like protein 1) | EBI-25771384 | 0.35 |
P01116 | GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed] | EBI-27041844 | 0.27 |
P01111 | GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras) | EBI-27042293 | 0.27 |
F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
A0A0H3NF08 | SPI-2 type III secretion system effector PipB2 (Type III secretion system effector protein, Contributes to Sif formation) | EBI-27055973 | 0.27 |
A0A0H3NB75 | Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV) | EBI-27055983 | 0.27 |
Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-27110926 | 0.35 |
P43250 | G protein-coupled receptor kinase 6 (EC 2.7.11.16) (G protein-coupled receptor kinase GRK6) | EBI-28935197 | 0.35 |
P57059 | Serine/threonine-protein kinase SIK1 (EC 2.7.11.1) (Salt-inducible kinase 1) (SIK-1) (Serine/threonine-protein kinase SNF1-like kinase 1) (Serine/threonine-protein kinase SNF1LK) | EBI-28938560 | 0.35 |
Q86UX6 | Serine/threonine-protein kinase 32C (EC 2.7.11.1) (PKE) (Yet another novel kinase 3) | EBI-28942129 | 0.35 |
Q8NG66 | Serine/threonine-protein kinase Nek11 (EC 2.7.11.1) (Never in mitosis A-related kinase 11) (NimA-related protein kinase 11) | EBI-28943501 | 0.35 |
Q8NI60 | Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3) | EBI-28943519 | 0.35 |
Q99640 | Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase) | EBI-28944893 | 0.35 |
P42695 | Condensin-2 complex subunit D3 (Non-SMC condensin II complex subunit D3) (hCAP-D3) | EBI-28951349 | 0.35 |
Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.35 |
O95600 | Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741) | EBI-29020196 | 0.35 |
P08922 | Proto-oncogene tyrosine-protein kinase ROS (EC 2.7.10.1) (Proto-oncogene c-Ros) (Proto-oncogene c-Ros-1) (Receptor tyrosine kinase c-ros oncogene 1) (c-Ros receptor tyrosine kinase) | EBI-32719572 | 0.35 |
Q16832 | Discoidin domain-containing receptor 2 (Discoidin domain receptor 2) (EC 2.7.10.1) (CD167 antigen-like family member B) (Discoidin domain-containing receptor tyrosine kinase 2) (Neurotrophic tyrosine kinase, receptor-related 3) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO10) (CD antigen CD167b) | EBI-32720227 | 0.27 |
P29320 | Ephrin type-A receptor 3 (EC 2.7.10.1) (EPH-like kinase 4) (EK4) (hEK4) (HEK) (Human embryo kinase) (Tyrosine-protein kinase TYRO4) (Tyrosine-protein kinase receptor ETK1) (Eph-like tyrosine kinase 1) | EBI-32720767 | 0.27 |
P29322 | Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK) | EBI-32721175 | 0.27 |
P21860 | Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3) | EBI-32721529 | 0.27 |
P11362 | Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) | EBI-32721578 | 0.27 |
P08069 | Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] | EBI-32722947 | 0.27 |
P06213 | Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta] | EBI-32723092 | 0.27 |
O15146 | Muscle, skeletal receptor tyrosine-protein kinase (EC 2.7.10.1) (Muscle-specific tyrosine-protein kinase receptor) (MuSK) (Muscle-specific kinase receptor) | EBI-32724025 | 0.27 |
Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32724526 | 0.27 |
P16234 | Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a) | EBI-32724889 | 0.27 |
P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-32725031 | 0.27 |
Q04912 | Macrophage-stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (CDw136) (Protein-tyrosine kinase 8) (p185-Ron) (CD antigen CD136) [Cleaved into: Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain] | EBI-32725158 | 0.27 |
Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2) | EBI-32725367 | 0.27 |
Database | Links |
UNIPROT | Q9P0L0 A6NDZ0 D3DUI3 O75453 Q5U0E7 Q9UBZ2 |
PDB | 2RR3 6TQR |
Pfam | PF00635 |
PROSITE | PS50202 |
OMIM | 605703 |
DisGeNET | 9218 |