Protein CASC3 - Homo sapiens

Protein CASC3 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein CASC3
Accession Code	O15234
Gene	CASC3
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 703)
MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAKSAEESECESE DGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVEN KVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALY GYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFK EGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIE KKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQ PSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTH GDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPG ALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS

Structure Viewer (PDB: 2J0U)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:12080473}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q8K3W3}. Nucleus {Experimental EvidencePubMed:12080473, Experimental EvidencePubMed:28502770, Experimental EvidencePubMed:29301961}. Nucleus speckle {Experimental EvidencePubMed:16170325}. Cytoplasm, Stress granule {Experimental EvidencePubMed:17652158}. Cytoplasm, Cytoplasmic ribonucleoprotein granule {By SimilarityUniProtKB:Q8K3X0}. Cell projection, dendrite {By SimilarityUniProtKB:Q8K3X0}. Note=Shuttles between the nucleus and the cytoplasm in a XPO1/CRM1-dependent manner. Transported to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA (PubMed:15166247). In nuclear speckles, colocalizes with MAGOH. Under stress conditions, colocalizes with FMR1 and TIA1, but not MAGOH and RBM8A EJC core factors, in cytoplasmic stress granules (PubMed:17652158). In the dendrites of hippocampal neurons, localizes to dendritic ribonucleoprotein granules (By similarity). {By SimilarityUniProtKB:Q8K3X0, ECO:0000269\|PubMed:15166247, Experimental EvidencePubMed:17652158}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasmic Stress Granule (GO:0010494) Cytosol (GO:0005829) Dendrite (GO:0030425) Exon-Exon Junction Complex (GO:0035145) Nuclear Membrane (GO:0031965) Nuclear Speck (GO:0016607) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) U2-Type Catalytic Step 1 Spliceosome (GO:0071006)

Biology & Function

Description
Required for pre-mRNA splicing as component of the spliceosome (PubMed:28502770, PubMed:29301961). Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Stimulates the ATPase and RNA-helicase activities of EIF4A3. Plays a role in the stress response by participating in cytoplasmic stress granules assembly and by favoring cell recovery following stress. Component of the dendritic ribonucleoprotein particles (RNPs) in hippocampal neurons. May play a role in mRNA transport. Binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions. Binds poly(G) and poly(U) RNA homomer. {Experimental EvidencePubMed:17375189, Experimental EvidencePubMed:17652158, Experimental EvidencePubMed:28502770, Experimental EvidencePubMed:29301961}.
Assigned Ontology terms

Biological Process	Intracellular MRNA Localization (GO:0008298) MRNA Export From Nucleus (GO:0006406) MRNA Splicing, Via Spliceosome (GO:0000398) Nuclear-Transcribed MRNA Catabolic Process, Nonsense-Mediated Decay (GO:0000184) Regulation Of Nuclear-Transcribed MRNA Catabolic Process, Nonsense-Mediated Decay (GO:2000622) Regulation Of Translation (GO:0006417)
Molecular Function	Enzyme Binding (GO:0019899) Identical Protein Binding (GO:0042802) MRNA Binding (GO:0003729) RNA Binding (GO:0003723) Ubiquitin Protein Ligase Binding (GO:0031625)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9UBU9	Nuclear RNA export factor 1	EBI-21728803	0.35
Q92900	Regulator of nonsense transcripts 1	EBI-15784788	0.70
Q9HAU5	Regulator of nonsense transcripts 2	EBI-15855293	0.70
Q9UPY3	Endoribonuclease Dicer	EBI-20621391	0.35
Interactions with other proteins (51 interactors)

Partner (UniProt)		IntAct	Confidence score
P38919	Eukaryotic initiation factor 4A-III (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase eIF4A-3) (DEAD box protein 48) (Eukaryotic initiation factor 4A-like NUK-34) (Eukaryotic translation initiation factor 4A isoform 3) (Nuclear matrix protein 265) (NMP 265) (hNMP 265) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed]	EBI-299122	0.98
P61326	Protein mago nashi homolog	EBI-299142	0.96
O95793	Double-stranded RNA-binding protein Staufen homolog 1	EBI-536629	0.35
Q9Y5S9	RNA-binding protein 8A (Binder of OVCA1-1) (BOV-1) (RNA-binding motif protein 8A) (RNA-binding protein Y14) (Ribonucleoprotein RBM8A)	EBI-15556968	0.86
Q9BZI7	Regulator of nonsense transcripts 3B (Nonsense mRNA reducing factor 3B) (Up-frameshift suppressor 3 homolog B) (hUpf3B) (Up-frameshift suppressor 3 homolog on chromosome X) (hUpf3p-X)	EBI-15674292	0.79
Q9H1J1	Regulator of nonsense transcripts 3A (Nonsense mRNA reducing factor 3A) (Up-frameshift suppressor 3 homolog A) (hUpf3)	EBI-3869363	0.35
P62993	Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2)	EBI-3937731	0.37
Q00534	Cyclin-dependent kinase 6 (EC 2.7.11.22) (Cell division protein kinase 6) (Serine/threonine-protein kinase PLSTIRE)	EBI-5292877	0.44
P04578	Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]	EBI-6176374	0.35
Q9Y2W1	Thyroid hormone receptor-associated protein 3 (BCLAF1 and THRAP3 family member 2) (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150)	EBI-6464350	0.40
Q86VP6	Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1)	EBI-21322532	0.35
P31749	RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha)	EBI-9065079	0.37
P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	EBI-9065274	0.37
Q14790	Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]	EBI-9066600	0.37
P42771	Cyclin-dependent kinase inhibitor 2A (Cyclin-dependent kinase 4 inhibitor A) (CDK4I) (Multiple tumor suppressor 1) (MTS-1) (p16-INK4a) (p16-INK4) (p16INK4A)	EBI-9067082	0.37
Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	EBI-9067732	0.37
P22455	Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)	EBI-9068122	0.37
O60934	Nibrin (Cell cycle regulatory protein p95) (Nijmegen breakage syndrome protein 1)	EBI-9068798	0.37
P35232	Prohibitin 1	EBI-9069474	0.37
P18031	Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B)	EBI-9069851	0.37
Q12913	Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)	EBI-9070007	0.37
P67809	Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor)	EBI-9985228	0.35
P41218	Myeloid cell nuclear differentiation antigen	EBI-9996028	0.35
Q6P1M3	LLGL scribble cell polarity complex component 2 (HGL) (Lethal(2) giant larvae protein homolog 2)	EBI-11024291	0.35
Q9CWZ3	RNA-binding protein 8A (RNA-binding motif protein 8A) (Ribonucleoprotein RBM8A)	EBI-11033143	0.35
Q93074	Mediator of RNA polymerase II transcription subunit 12 (Activator-recruited cofactor 240 kDa component) (ARC240) (CAG repeat protein 45) (Mediator complex subunit 12) (OPA-containing protein) (Thyroid hormone receptor-associated protein complex 230 kDa component) (Trap230) (Trinucleotide repeat-containing gene 11 protein)	EBI-11039728	0.35
Q9D902	General transcription factor IIE subunit 2 (Transcription initiation factor IIE subunit beta) (TFIIE-beta)	EBI-11096128	0.35
Q8NB78	Lysine-specific histone demethylase 2 (EC 1.14.99.66) (Flavin-containing amine oxidase domain-containing protein 1) (Lysine-specific histone demethylase 1B)	EBI-11101709	0.35
Q7LFX5	Carbohydrate sulfotransferase 15 (EC 2.8.2.33) (B-cell RAG-associated gene protein) (hBRAG) (N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase) (GalNAc4S-6ST)	EBI-11123526	0.35
Q6P5F9	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-11603310	0.35
Q3LI66	Keratin-associated protein 6-2	EBI-24633422	0.56
Q9UEU0	Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1)	EBI-21525256	0.35
P47902	Homeobox protein CDX-1 (Caudal-type homeobox protein 1)	EBI-21581572	0.35
Q12926	ELAV-like protein 2 (ELAV-like neuronal protein 1) (Hu-antigen B) (HuB) (Nervous system-specific RNA-binding protein Hel-N1)	EBI-21666158	0.35
Q8IYD1	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B (Eukaryotic peptide chain release factor subunit 3b) (eRF3b) (G1 to S phase transition protein 2 homolog)	EBI-21666681	0.35
Q96AK3	DNA dC->dU-editing enzyme APOBEC-3D (A3D) (A3DE) (EC 3.5.4.38)	EBI-21666867	0.35
Q13595	Transformer-2 protein homolog alpha (TRA-2 alpha) (TRA2-alpha) (Transformer-2 protein homolog A)	EBI-21690239	0.35
P26368	Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (hU2AF(65)) (hU2AF65) (U2 snRNP auxiliary factor large subunit)	EBI-21718427	0.35
P49760	Dual specificity protein kinase CLK2 (EC 2.7.12.1) (CDC-like kinase 2)	EBI-21726948	0.35
Q6ZUT1	Uncharacterized protein NKAPD1 (NKAP domain containing protein 1)	EBI-21727187	0.35
Q8N6W0	CUGBP Elav-like family member 5 (CELF-5) (Bruno-like protein 5) (CUG-BP- and ETR-3-like factor 5) (RNA-binding protein BRUNOL-5)	EBI-21727590	0.35
Q8TAD8	Smad nuclear-interacting protein 1 (FHA domain-containing protein SNIP1)	EBI-21727669	0.35
Q9H307	Pinin (140 kDa nuclear and cell adhesion-related phosphoprotein) (Desmosome-associated protein) (Domain-rich serine protein) (DRS protein) (DRSP) (Melanoma metastasis clone A protein) (Nuclear protein SDK3) (SR-like protein)	EBI-21728050	0.35
Q9NQ29	Putative RNA-binding protein Luc7-like 1 (Putative SR protein LUC7B1) (SR+89)	EBI-21728243	0.35
Q9BRP8	Partner of Y14 and mago (PYM homolog 1 exon junction complex-associated factor) (Protein wibg homolog)	EBI-21727928	0.35
Q9NQX1	PR domain zinc finger protein 5 (EC 2.1.1.-) (PR domain-containing protein 5)	EBI-21728580	0.35
Q9Y383	Putative RNA-binding protein Luc7-like 2	EBI-21728858	0.35
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21302175	0.35
Q92574	Hamartin (Tuberous sclerosis 1 protein)	EBI-26515506	0.37
O60306	RNA helicase aquarius (EC 3.6.4.13) (Intron-binding protein of 160 kDa) (IBP160)	EBI-26901687	0.32
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27109494	0.35

Cross-References

Database	Links
UNIPROT	O15234 A8K8R0
PDB	2HYI 2J0Q 2J0S 2J0U 2XB2 3EX7 5XJC 5YZG 6ICZ
Pfam	PF09405
OMIM	606504
DisGeNET	22794

Protein CASC3 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 2J0U)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (51 interactors)

Cross-References

Database

Links

Description

Description