Protein Information |
|
|---|---|
| Protein Name | Nuclear RNA export factor 1 |
| Accession Code | Q9UBU9 |
| Gene | NXF1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 619) | |
|
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPN RRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQ FFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEEL WLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDS GDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPV PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK |
|
Structure Viewer (PDB: 6E5U) |
|---|
Description |
||
|---|---|---|
| Nucleus {Experimental EvidencePubMed:10924507, Experimental EvidencePubMed:18596238, Experimental EvidencePubMed:19864460, Experimental EvidencePubMed:23591820, Experimental EvidencePubMed:25662211}. Nucleus, nucleoplasm {Experimental EvidencePubMed:19324961, Experimental EvidencePubMed:23826332}. Nucleus speckle {Experimental EvidencePubMed:19324961, Experimental EvidencePubMed:23826332}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:23591820}. Nucleus envelope {Experimental EvidencePubMed:18596238, Experimental EvidencePubMed:23591820}. Cytoplasm {Experimental EvidencePubMed:10924507, Experimental EvidencePubMed:18596238, Experimental EvidencePubMed:19324961, Experimental EvidencePubMed:19864460}. Cytoplasm, Stress granule {Experimental EvidencePubMed:18596238}. Note=Localized predominantly in the nucleoplasm and at both the nucleoplasmic and cytoplasmic faces of the nuclear pore complex. Shuttles between the nucleus and the cytoplasm. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA. The association with the TREX complex seems to occur in regions surrounding nuclear speckles known as perispeckles (PubMed:23826332). Nucleus; nuclear rim (PubMed:25662211). {Experimental EvidencePubMed:23826332, Experimental EvidencePubMed:25662211}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Pore Complex | SL-0185 | The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs). | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytoplasmic Stress Granule (GO:0010494) Cytosol (GO:0005829) Nuclear Inclusion Body (GO:0042405) Nuclear Pore (GO:0005643) Nuclear RNA Export Factor Complex (GO:0042272) Nuclear Speck (GO:0016607) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) |
|
Description |
|
|---|---|
| Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm (TAP/NFX1 pathway) (PubMed:10924507). The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5 components of the TREX complex (PubMed:18364396, PubMed:19165146, PubMed:9660949). ALYREF/THOC4-bound mRNA is thought to be transferred to the NXF1-NXT1 heterodimer for export (PubMed:18364396, PubMed:19165146, PubMed:9660949). Also involved in nuclear export of m6A-containing mRNAs: interaction between SRSF3 and YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export (PubMed:28984244). {Experimental EvidencePubMed:10924507, Experimental EvidencePubMed:18364396, Experimental EvidencePubMed:19165146, Experimental EvidencePubMed:28984244, Experimental EvidencePubMed:9660949}. | Assigned Ontology terms |
| Biological Process | MRNA Export From Nucleus (GO:0006406) Poly(A)+ MRNA Export From Nucleus (GO:0016973) Protein Transport (GO:0015031) |
| Molecular Function | MRNA Binding (GO:0003729) RNA Binding (GO:0003723) |
Interactions with Nuclear Envelope proteins (24 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-26495696 | 0.35 |
| P46060 | Ran GTPase-activating protein 1 | EBI-6262548 | 0.53 |
| P49792 | E3 SUMO-protein ligase RanBP2 | EBI-6262548 | 0.53 |
| P63279 | SUMO-conjugating enzyme UBC9 | EBI-11105225 | 0.35 |
| P78406 | mRNA export factor RAE1 | EBI-7193130 | 0.54 |
| Q06609 | DNA repair protein RAD51 homolog 1 | EBI-3914918 | 0.37 |
| Q92900 | Regulator of nonsense transcripts 1 | EBI-3867844 | 0.35 |
| Q96EE3 | Nucleoporin SEH1 | EBI-11086798 | 0.35 |
| Q9ERU9 | E3 SUMO-protein ligase RanBP2 | EBI-2555617 | 0.56 |
| Q9NRR5 | Ubiquilin-4 | EBI-955046 | 0.00 |
| Q13625 | Apoptosis-stimulating of p53 protein 2 | EBI-10319914 | 0.56 |
| O15234 | Protein CASC3 | EBI-21728803 | 0.35 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| Q53GS7 | mRNA export factor GLE1 | EBI-21728803 | 0.35 |
| Q14974 | Importin subunit beta-1 | EBI-11115566 | 0.35 |
| P57740 | Nuclear pore complex protein Nup107 | EBI-11160436 | 0.35 |
| Q8BH74 | Nuclear pore complex protein Nup107 | EBI-10997196 | 0.35 |
| Q8WUM0 | Nuclear pore complex protein Nup133 | EBI-6262548 | 0.35 |
| P49790 | Nuclear pore complex protein Nup153 | EBI-7193245 | 0.76 |
| P35658 | Nuclear pore complex protein Nup214 | EBI-7193202 | 0.69 |
| P37198 | Nuclear pore glycoprotein p62 | EBI-7193172 | 0.88 |
| Q99567 | Nuclear pore complex protein Nup88 | EBI-6262548 | 0.35 |
| P52948 | Nuclear pore complex protein Nup96 | EBI-7193058 | 0.61 |
| Q6PFD9 | Nuclear pore complex protein Nup96 | EBI-10994876 | 0.35 | Interactions with other proteins (146 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q08211 | ATP-dependent RNA helicase A (EC 3.6.4.13) (DEAH box protein 9) (DExH-box helicase 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) (RNA helicase A) | EBI-866311 | 0.76 |
| Q92973 | Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP) | EBI-7193088 | 0.54 |
| Q9BUJ2 | Heterogeneous nuclear ribonucleoprotein U-like protein 1 (Adenovirus early region 1B-associated protein 5) (E1B-55 kDa-associated protein 5) (E1B-AP5) | EBI-7193279 | 0.54 |
| Q9UKK6 | NTF2-related export protein 1 (Protein p15) | EBI-1032165 | 0.84 |
| Q16629 | Serine/arginine-rich splicing factor 7 (Splicing factor 9G8) (Splicing factor, arginine/serine-rich 7) | EBI-398917 | 0.67 |
| Q07955 | Serine/arginine-rich splicing factor 1 (Alternative-splicing factor 1) (ASF-1) (Splicing factor, arginine/serine-rich 1) (pre-mRNA-splicing factor SF2, P33 subunit) | EBI-398948 | 0.76 |
| P38919 | Eukaryotic initiation factor 4A-III (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase eIF4A-3) (DEAD box protein 48) (Eukaryotic initiation factor 4A-like NUK-34) (Eukaryotic translation initiation factor 4A isoform 3) (Nuclear matrix protein 265) (NMP 265) (hNMP 265) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed] | EBI-619182 | 0.35 |
| P22575 | Tyrosine-protein kinase-interacting protein (Tip) | EBI-866704 | 0.62 |
| P84103 | Serine/arginine-rich splicing factor 3 (Pre-mRNA-splicing factor SRP20) (Splicing factor, arginine/serine-rich 3) | EBI-7034677 | 0.54 |
| P06730 | Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein) | EBI-8582156 | 0.35 |
| Q09161 | Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit) | EBI-8582181 | 0.35 |
| Q81WW5 | DUF420 domain-containing protein | EBI-2828496 | 0.00 |
| Q81WF3 | Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit (Dihydroorotate oxidase B, electron transfer subunit) | EBI-2828485 | 0.00 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-3048562 | 0.35 |
| O95166 | Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46) | EBI-3050465 | 0.35 |
| Q9H1J1 | Regulator of nonsense transcripts 3A (Nonsense mRNA reducing factor 3A) (Up-frameshift suppressor 3 homolog A) (hUpf3) | EBI-3866025 | 0.53 |
| Q9BZI7 | Regulator of nonsense transcripts 3B (Nonsense mRNA reducing factor 3B) (Up-frameshift suppressor 3 homolog B) (hUpf3B) (Up-frameshift suppressor 3 homolog on chromosome X) (hUpf3p-X) | EBI-3866041 | 0.53 |
| Q9Y5S9 | RNA-binding protein 8A (Binder of OVCA1-1) (BOV-1) (RNA-binding motif protein 8A) (RNA-binding protein Y14) (Ribonucleoprotein RBM8A) | EBI-3867848 | 0.40 |
| Q15287 | RNA-binding protein with serine-rich domain 1 (SR-related protein LDC2) | EBI-3867852 | 0.40 |
| Q8IYB3 | Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein) | EBI-3867860 | 0.40 |
| Q86V81 | THO complex subunit 4 (Tho4) (Ally of AML-1 and LEF-1) (Aly/REF export factor) (Transcriptional coactivator Aly/REF) (bZIP-enhancing factor BEF) | EBI-3869257 | 0.66 |
| Q9NXV2 | BTB/POZ domain-containing protein KCTD5 | EBI-3922211 | 0.49 |
| P11474 | Steroid hormone receptor ERR1 (Estrogen receptor-like 1) (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1) | EBI-3935683 | 0.37 |
| O43765 | Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) (Vpu-binding protein) (UBP) | EBI-3935713 | 0.37 |
| P62995 | Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (hTRA2-beta) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B) | EBI-3935703 | 0.37 |
| Q13595 | Transformer-2 protein homolog alpha (TRA-2 alpha) (TRA2-alpha) (Transformer-2 protein homolog A) | EBI-3941843 | 0.37 |
| Q9BTP6 | Zinc finger BED domain-containing protein 2 | EBI-3941863 | 0.37 |
| P68400 | Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1) | EBI-5295255 | 0.44 |
| P36578 | 60S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4) | EBI-6262560 | 0.35 |
| Q14444 | Caprin-1 (Cell cycle-associated protein 1) (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored membrane protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule protein 105) | EBI-6262560 | 0.35 |
| Q9Y2W1 | Thyroid hormone receptor-associated protein 3 (BCLAF1 and THRAP3 family member 2) (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150) | EBI-6262560 | 0.62 |
| P39023 | 60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) (Large ribosomal subunit protein uL3) | EBI-6262560 | 0.35 |
| O00571 | ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3, X-chromosomal) (DEAD box, X isoform) (DBX) (Helicase-like protein 2) (HLP2) | EBI-6262560 | 0.60 |
| P62424 | 60S ribosomal protein L7a (Large ribosomal subunit protein eL8) (PLA-X polypeptide) (Surfeit locus protein 3) | EBI-6262560 | 0.35 |
| Q02878 | 60S ribosomal protein L6 (Large ribosomal subunit protein eL6) (Neoplasm-related protein C140) (Tax-responsive enhancer element-binding protein 107) (TaxREB107) | EBI-6262560 | 0.35 |
| P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-6262560 | 0.35 |
| P23396 | 40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3) | EBI-6262560 | 0.35 |
| P62917 | 60S ribosomal protein L8 (Large ribosomal subunit protein uL2) | EBI-6262560 | 0.35 |
| P19338 | Nucleolin (Protein C23) | EBI-6262560 | 0.35 |
| Q00839 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120) | EBI-6262560 | 0.35 |
| P11940 | Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1) | EBI-6262659 | 0.40 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| P10238 | mRNA export factor (Immediate-early protein IE63) (Infected cell protein 27) (ICP27) (VMW63) | EBI-8845500 | 0.62 |
| Q9Y3Y2 | Chromatin target of PRMT1 protein (Friend of PRMT1 protein) (Small arginine- and glycine-rich protein) (SRAG) | EBI-9077975 | 0.65 |
| Q96QD9 | UAP56-interacting factor (Forty-two-three domain-containing protein 1) (Protein 40-2-3) | EBI-9085098 | 0.35 |
| Q96FV9 | THO complex subunit 1 (Tho1) (Nuclear matrix protein p84) (p84N5) (hTREX84) | EBI-9085185 | 0.35 |
| Q13769 | THO complex subunit 5 homolog (Functional spliceosome-associated protein 79) (fSAP79) (NF2/meningioma region protein pK1.3) (Placental protein 39.2) (PP39.2) (hTREX90) | EBI-9085185 | 0.35 |
| Q8NI27 | THO complex subunit 2 (Tho2) (hTREX120) | EBI-9085185 | 0.35 |
| B4DYC6 | cDNA FLJ60958, highly similar to Homo sapiens SGT1, suppressor of G2 allele of SKP1 (SUGT1), mRNA | EBI-9484856 | 0.40 |
| Q96RS6 | NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66) | EBI-9484872 | 0.40 |
| O95751 | Protein LDOC1 (Leucine zipper protein down-regulated in cancer cells) | EBI-10319882 | 0.67 |
| P14136 | Glial fibrillary acidic protein (GFAP) | EBI-10319892 | 0.78 |
| Q6A162 | Keratin, type I cytoskeletal 40 (Cytokeratin-40) (CK-40) (Keratin-40) (K40) (Type I hair keratin Ka36) | EBI-10319926 | 0.56 |
| Q92997 | Segment polarity protein dishevelled homolog DVL-3 (Dishevelled-3) (DSH homolog 3) | EBI-10319936 | 0.56 |
| Q96CG3 | TRAF-interacting protein with FHA domain-containing protein A (Putative MAPK-activating protein PM14) (Putative NF-kappa-B-activating protein 20) (TRAF2-binding protein) | EBI-10319946 | 0.72 |
| Q9UJV3 | Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1) | EBI-10319956 | 0.56 |
| P17844 | Probable ATP-dependent RNA helicase DDX5 (EC 3.6.4.13) (DEAD box protein 5) (RNA helicase p68) | EBI-10096841 | 0.40 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
| P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-11035646 | 0.35 |
| Q8VE37 | Regulator of chromosome condensation (Chromosome condensation protein 1) | EBI-11043815 | 0.35 |
| P63280 | SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I) | EBI-11044140 | 0.35 |
| Q68CZ1 | Protein fantom (Nephrocystin-8) (RPGR-interacting protein 1-like protein) (RPGRIP1-like protein) | EBI-11368346 | 0.27 |
| P41219 | Peripherin (Neurofilament 4) | EBI-24298299 | 0.56 |
| O75031 | Heat shock factor 2-binding protein | EBI-24498836 | 0.56 |
| P49639 | Homeobox protein Hox-A1 (Homeobox protein Hox-1F) | EBI-24510395 | 0.56 |
| Q9H079 | KATNB1-like protein 1 (Katanin p80 subunit B-like 1) | EBI-24515747 | 0.56 |
| P49761 | Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3) | EBI-24515603 | 0.56 |
| Q13867 | Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40) | EBI-24523474 | 0.56 |
| P49760 | Dual specificity protein kinase CLK2 (EC 2.7.12.1) (CDC-like kinase 2) | EBI-24524233 | 0.56 |
| Q86WS4 | Uncharacterized protein C12orf40 | EBI-25264291 | 0.56 |
| Q9BX10 | GTP-binding protein 2 | EBI-24622152 | 0.56 |
| Q9BQ95 | Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (Protein SITPEC) | EBI-24628881 | 0.56 |
| P79522 | Proline-rich protein 3 (MHC class I region proline-rich protein CAT56) | EBI-24660575 | 0.56 |
| P15622 | Zinc finger protein 250 (Zinc finger protein 647) | EBI-24661566 | 0.56 |
| Q9UK41 | Vacuolar protein sorting-associated protein 28 homolog (H-Vps28) (ESCRT-I complex subunit VPS28) | EBI-24666279 | 0.56 |
| Q6ZUT1 | Uncharacterized protein NKAPD1 (NKAP domain containing protein 1) | EBI-24668590 | 0.56 |
| B2RXH4 | BTB/POZ domain-containing protein 18 | EBI-24673822 | 0.56 |
| Q6NTE8 | MRN complex-interacting protein (MRN-interacting protein) | EBI-24678138 | 0.56 |
| Q8N6V9 | Testis-expressed protein 9 | EBI-24680526 | 0.56 |
| A0A1B0GWI1 | Putative coiled-coil domain-containing protein 196 | EBI-23711325 | 0.56 |
| Q5T5B0 | Late cornified envelope protein 3E (Late envelope protein 17) | EBI-24686853 | 0.56 |
| Q9ULR0 | Pre-mRNA-splicing factor ISY1 homolog | EBI-24705892 | 0.56 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-24724810 | 0.56 |
| O00746 | Nucleoside diphosphate kinase, mitochondrial (NDK) (NDP kinase, mitochondrial) (EC 2.7.4.6) (Nucleoside diphosphate kinase D) (NDPKD) (nm23-H4) | EBI-23790873 | 0.56 |
| Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C (Protein phosphatase 1 myosin-binding subunit of 85 kDa) (Protein phosphatase 1 myosin-binding subunit p85) | EBI-24733395 | 0.56 |
| Q8IZU3 | Synaptonemal complex protein 3 (SCP-3) | EBI-24735253 | 0.56 |
| Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa] | EBI-24738527 | 0.56 |
| Q96M83 | Coiled-coil domain-containing protein 7 (Protein BIOT2) | EBI-24743255 | 0.56 |
| Q9NQY0 | Bridging integrator 3 | EBI-24754052 | 0.56 |
| Q9H7T9 | Aurora kinase A and ninein-interacting protein (AIBp) | EBI-24755679 | 0.56 |
| Q96DF8 | Splicing factor ESS-2 homolog (DiGeorge syndrome critical region 13) (DiGeorge syndrome critical region 14) (DiGeorge syndrome protein H) (DGS-H) (Protein ES2) | EBI-24767131 | 0.56 |
| Q9NR46 | Endophilin-B2 (SH3 domain-containing GRB2-like protein B2) | EBI-24770768 | 0.56 |
| Q7Z4V0 | Zinc finger protein 438 | EBI-24778309 | 0.56 |
| Q5SWW7 | Uncharacterized protein C10orf55 | EBI-24779073 | 0.56 |
| Q96P16 | Regulation of nuclear pre-mRNA domain-containing protein 1A (Cyclin-dependent kinase inhibitor 2B-related protein) (p15INK4B-related protein) | EBI-24779655 | 0.56 |
| Q8TDR4 | T-complex protein 10A homolog 1 (T-complex protein 10A-1) (TCP10A-1) (TCP10-like) | EBI-24797571 | 0.56 |
| Q6P1L6 | Zinc finger protein 343 | EBI-25280752 | 0.56 |
| Q13555 | Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17) | EBI-24372650 | 0.56 |
| A6NEM1 | Golgin subfamily A member 6-like protein 9 | EBI-24375283 | 0.56 |
| Q5JR59 | Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa) | EBI-24388879 | 0.56 |
| Q9BYV9 | Transcription regulator protein BACH2 (BTB and CNC homolog 2) | EBI-24392545 | 0.56 |
| Q9UMX0 | Ubiquilin-1 (Protein linking IAP with cytoskeleton 1) (PLIC-1) (hPLIC-1) | EBI-24446611 | 0.56 |
| Q13490 | Baculoviral IAP repeat-containing protein 2 (EC 2.3.2.27) (Cellular inhibitor of apoptosis 1) (C-IAP1) (IAP homolog B) (Inhibitor of apoptosis protein 2) (hIAP-2) (hIAP2) (RING finger protein 48) (RING-type E3 ubiquitin transferase BIRC2) (TNFR2-TRAF-signaling complex protein 2) | EBI-24538264 | 0.56 |
| Q8IZU1 | Protein FAM9A | EBI-24539795 | 0.56 |
| Q8WWB5 | PIH1 domain-containing protein 2 | EBI-24551261 | 0.56 |
| Q8N8U2 | Chromodomain Y-like protein 2 (CDY-like 2) | EBI-24581617 | 0.56 |
| Q86WP2 | Vasculin (GC-rich promoter-binding protein 1) (Vascular wall-linked protein) | EBI-24598279 | 0.56 |
| P31321 | cAMP-dependent protein kinase type I-beta regulatory subunit | EBI-24598989 | 0.56 |
| Q9H0A9 | Speriolin-like protein (Spermatogenesis and centriole-associated protein 1-like protein) | EBI-24646318 | 0.56 |
| Q96HB5 | Coiled-coil domain-containing protein 120 | EBI-24647419 | 0.56 |
| Q8NCU1 | Uncharacterized protein CCDC197 (Coiled-coil domain-containing protein 197) | EBI-24656214 | 0.56 |
| Q8WWY6 | Methyl-CpG-binding domain protein 3-like 1 (MBD3-like protein 1) | EBI-24657169 | 0.56 |
| Q13829 | BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (hBACURD2) (BTB/POZ domain-containing protein TNFAIP1) (Protein B12) (Tumor necrosis factor, alpha-induced protein 1, endothelial) | EBI-24777447 | 0.56 |
| Q8ND83 | SLAIN motif-containing protein 1 | EBI-25203964 | 0.56 |
| Q96MP8 | BTB/POZ domain-containing protein KCTD7 | EBI-24809398 | 0.56 |
| Q9C0B1 | Alpha-ketoglutarate-dependent dioxygenase FTO (Fat mass and obesity-associated protein) (U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO) (EC 1.14.11.-) (U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO) (EC 1.14.11.-) (mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO) (m6A(m)-demethylase FTO) (EC 1.14.11.-) (mRNA N(6)-methyladenosine demethylase FTO) (EC 1.14.11.53) (tRNA N1-methyl adenine demethylase FTO) (EC 1.14.11.-) | EBI-25266832 | 0.56 |
| Q9P2M4 | TBC1 domain family member 14 | EBI-25269837 | 0.56 |
| Q8IVT5 | Kinase suppressor of Ras 1 (EC 2.7.11.1) | EBI-14035831 | 0.35 |
| Q9Y2Z4 | Tyrosine--tRNA ligase, mitochondrial (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) | EBI-21728803 | 0.35 |
| Q9H000 | E3 ubiquitin-protein ligase makorin-2 (EC 2.3.2.27) (RING finger protein 62) (RING-type E3 ubiquitin transferase makorin-2) | EBI-21728803 | 0.35 |
| Q99666 | RANBP2-like and GRIP domain-containing protein 5/6 (Ran-binding protein 2-like 1/2) (RanBP2-like 1/2) (RanBP2L1) (RanBP2L2) (Sperm membrane protein BS-63) | EBI-21728803 | 0.35 |
| Q53F19 | Nuclear cap-binding protein subunit 3 (Protein ELG) | EBI-21728803 | 0.35 |
| O15354 | Prosaposin receptor GPR37 (Endothelin B receptor-like protein 1) (ETBR-LP-1) (G-protein coupled receptor 37) (Parkin-associated endothelin receptor-like receptor) (PAELR) | EBI-21812535 | 0.35 |
| Q9NPJ8 | NTF2-related export protein 2 (Protein p15-2) | EBI-21875490 | 0.35 |
| Q82506 | Non-structural protein 1 (NS1) (NS1A) | EBI-15620563 | 0.35 |
| Q9BTM9 | Ubiquitin-related modifier 1 | EBI-15902832 | 0.35 |
| P03430 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-25769373 | 0.37 |
| P15659 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-25769186 | 0.37 |
| P03427 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-25769439 | 0.37 |
| P46013 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67) | EBI-20562326 | 0.35 |
| O76021 | Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1) | EBI-20924306 | 0.40 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
| Q2HR75 | mRNA export factor ICP27 homolog (EB2 protein homolog) | EBI-22084769 | 0.35 |
| P10644 | cAMP-dependent protein kinase type I-alpha regulatory subunit (Tissue-specific extinguisher 1) (TSE1) | EBI-25387530 | 0.35 |
| Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-26610537 | 0.35 |
| Q96KG9 | N-terminal kinase-like protein (Coated vesicle-associated kinase of 90 kDa) (SCY1-like protein 1) (Telomerase regulation-associated protein) (Telomerase transcriptional element-interacting factor) (Teratoma-associated tyrosine kinase) | EBI-28944481 | 0.35 |
| Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-28955349 | 0.35 |
| Q93009 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-30844801 | 0.44 |
| A6NLX3 | Speedy protein E4 | EBI-28997234 | 0.27 |
| Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.35 |
| P30530 | Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene) | EBI-32719959 | 0.27 |
| P36888 | Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135) | EBI-32722567 | 0.27 |
Database | Links |
| UNIPROT | Q9UBU9 B4E269 Q99799 Q9UQL2 |
| PDB | 1FO1 1FT8 1GO5 1JKG 1JN5 1KOH 1KOO 1OAI 2Z5K 2Z5M 3RW6 3RW7 4WYK 6E5U |
| Pfam | PF02136 PF09162 PF03943 |
| PROSITE | PS51450 PS50177 PS51281 |
| OMIM | 602647 |
| DisGeNET | 10482 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory