Nuclear RNA export factor 1 - Homo sapiens

Nuclear RNA export factor 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear RNA export factor 1
Accession Code	Q9UBU9
Gene	NXF1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 619)
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPN RRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQ FFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEEL WLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDS GDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPV PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK

Structure Viewer (PDB: 3RW7)

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:10924507, Experimental EvidencePubMed:18596238, Experimental EvidencePubMed:19864460, Experimental EvidencePubMed:23591820, Experimental EvidencePubMed:25662211}. Nucleus, nucleoplasm {Experimental EvidencePubMed:19324961, Experimental EvidencePubMed:23826332}. Nucleus speckle {Experimental EvidencePubMed:19324961, Experimental EvidencePubMed:23826332}. Nucleus, nuclear pore complex {Experimental EvidencePubMed:23591820}. Nucleus envelope {Experimental EvidencePubMed:18596238, Experimental EvidencePubMed:23591820}. Cytoplasm {Experimental EvidencePubMed:10924507, Experimental EvidencePubMed:18596238, Experimental EvidencePubMed:19324961, Experimental EvidencePubMed:19864460}. Cytoplasm, Stress granule {Experimental EvidencePubMed:18596238}. Note=Localized predominantly in the nucleoplasm and at both the nucleoplasmic and cytoplasmic faces of the nuclear pore complex. Shuttles between the nucleus and the cytoplasm. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA. The association with the TREX complex seems to occur in regions surrounding nuclear speckles known as perispeckles (PubMed:23826332). Nucleus; nuclear rim (PubMed:25662211). {Experimental EvidencePubMed:23826332, Experimental EvidencePubMed:25662211}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytoplasmic Stress Granule (GO:0010494) Cytosol (GO:0005829) Nuclear Inclusion Body (GO:0042405) Nuclear Pore (GO:0005643) Nuclear RNA Export Factor Complex (GO:0042272) Nuclear Speck (GO:0016607) Nucleoplasm (GO:0005654) Nucleus (GO:0005634)

Biology & Function

Description
Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm (TAP/NFX1 pathway) (PubMed:10924507). The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5 components of the TREX complex (PubMed:18364396, PubMed:19165146, PubMed:9660949). ALYREF/THOC4-bound mRNA is thought to be transferred to the NXF1-NXT1 heterodimer for export (PubMed:18364396, PubMed:19165146, PubMed:9660949). Also involved in nuclear export of m6A-containing mRNAs: interaction between SRSF3 and YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export (PubMed:28984244). {Experimental EvidencePubMed:10924507, Experimental EvidencePubMed:18364396, Experimental EvidencePubMed:19165146, Experimental EvidencePubMed:28984244, Experimental EvidencePubMed:9660949}.
Assigned Ontology terms

Biological Process	MRNA Export From Nucleus (GO:0006406) Poly(A)+ MRNA Export From Nucleus (GO:0016973) Protein Transport (GO:0015031)
Molecular Function	MRNA Binding (GO:0003729) RNA Binding (GO:0003723)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (24 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P0DTD1	2'-O-methyltransferase nsp16	EBI-26495696	0.35
P46060	Ran GTPase-activating protein 1	EBI-6262548	0.53
P49792	E3 SUMO-protein ligase RanBP2	EBI-6262548	0.53
P63279	SUMO-conjugating enzyme UBC9	EBI-11105225	0.35
P78406	mRNA export factor RAE1	EBI-7193130	0.54
Q06609	DNA repair protein RAD51 homolog 1	EBI-3914918	0.37
Q92900	Regulator of nonsense transcripts 1	EBI-3867844	0.35
Q96EE3	Nucleoporin SEH1	EBI-11086798	0.35
Q9ERU9	E3 SUMO-protein ligase RanBP2	EBI-2555617	0.56
Q9NRR5	Ubiquilin-4	EBI-955046	0.00
Q13625	Apoptosis-stimulating of p53 protein 2	EBI-10319914	0.56
O15234	Protein CASC3	EBI-21728803	0.35
Q92905	COP9 signalosome complex subunit 5	EBI-21325777	0.35
Q53GS7	mRNA export factor GLE1	EBI-21728803	0.35
Q14974	Importin subunit beta-1	EBI-11115566	0.35
P57740	Nuclear pore complex protein Nup107	EBI-11160436	0.35
Q8BH74	Nuclear pore complex protein Nup107	EBI-10997196	0.35
Q8WUM0	Nuclear pore complex protein Nup133	EBI-6262548	0.35
P49790	Nuclear pore complex protein Nup153	EBI-7193245	0.76
P35658	Nuclear pore complex protein Nup214	EBI-7193202	0.69
P37198	Nuclear pore glycoprotein p62	EBI-7193172	0.88
Q99567	Nuclear pore complex protein Nup88	EBI-6262548	0.35
P52948	Nuclear pore complex protein Nup96	EBI-7193058	0.61
Q6PFD9	Nuclear pore complex protein Nup96	EBI-10994876	0.35
Interactions with other proteins (146 interactors)

Partner (UniProt)		IntAct	Confidence score
Q08211	ATP-dependent RNA helicase A (EC 3.6.4.13) (DEAH box protein 9) (DExH-box helicase 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) (RNA helicase A)	EBI-866311	0.76
Q92973	Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP)	EBI-7193088	0.54
Q9BUJ2	Heterogeneous nuclear ribonucleoprotein U-like protein 1 (Adenovirus early region 1B-associated protein 5) (E1B-55 kDa-associated protein 5) (E1B-AP5)	EBI-7193279	0.54
Q9UKK6	NTF2-related export protein 1 (Protein p15)	EBI-1032165	0.84
Q16629	Serine/arginine-rich splicing factor 7 (Splicing factor 9G8) (Splicing factor, arginine/serine-rich 7)	EBI-398917	0.67
Q07955	Serine/arginine-rich splicing factor 1 (Alternative-splicing factor 1) (ASF-1) (Splicing factor, arginine/serine-rich 1) (pre-mRNA-splicing factor SF2, P33 subunit)	EBI-398948	0.76
P38919	Eukaryotic initiation factor 4A-III (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase eIF4A-3) (DEAD box protein 48) (Eukaryotic initiation factor 4A-like NUK-34) (Eukaryotic translation initiation factor 4A isoform 3) (Nuclear matrix protein 265) (NMP 265) (hNMP 265) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed]	EBI-619182	0.35
P22575	Tyrosine-protein kinase-interacting protein (Tip)	EBI-866704	0.62
P84103	Serine/arginine-rich splicing factor 3 (Pre-mRNA-splicing factor SRP20) (Splicing factor, arginine/serine-rich 3)	EBI-7034677	0.54
P06730	Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein)	EBI-8582156	0.35
Q09161	Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit)	EBI-8582181	0.35
Q81WW5	DUF420 domain-containing protein	EBI-2828496	0.00
Q81WF3	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit (Dihydroorotate oxidase B, electron transfer subunit)	EBI-2828485	0.00
Q9H0R8	Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1)	EBI-3048562	0.35
O95166	Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46)	EBI-3050465	0.35
Q9H1J1	Regulator of nonsense transcripts 3A (Nonsense mRNA reducing factor 3A) (Up-frameshift suppressor 3 homolog A) (hUpf3)	EBI-3866025	0.53
Q9BZI7	Regulator of nonsense transcripts 3B (Nonsense mRNA reducing factor 3B) (Up-frameshift suppressor 3 homolog B) (hUpf3B) (Up-frameshift suppressor 3 homolog on chromosome X) (hUpf3p-X)	EBI-3866041	0.53
Q9Y5S9	RNA-binding protein 8A (Binder of OVCA1-1) (BOV-1) (RNA-binding motif protein 8A) (RNA-binding protein Y14) (Ribonucleoprotein RBM8A)	EBI-3867848	0.40
Q15287	RNA-binding protein with serine-rich domain 1 (SR-related protein LDC2)	EBI-3867852	0.40
Q8IYB3	Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein)	EBI-3867860	0.40
Q86V81	THO complex subunit 4 (Tho4) (Ally of AML-1 and LEF-1) (Aly/REF export factor) (Transcriptional coactivator Aly/REF) (bZIP-enhancing factor BEF)	EBI-3869257	0.66
Q9NXV2	BTB/POZ domain-containing protein KCTD5	EBI-3922211	0.49
P11474	Steroid hormone receptor ERR1 (Estrogen receptor-like 1) (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1)	EBI-3935683	0.37
O43765	Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) (Vpu-binding protein) (UBP)	EBI-3935713	0.37
P62995	Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (hTRA2-beta) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B)	EBI-3935703	0.37
Q13595	Transformer-2 protein homolog alpha (TRA-2 alpha) (TRA2-alpha) (Transformer-2 protein homolog A)	EBI-3941843	0.37
Q9BTP6	Zinc finger BED domain-containing protein 2	EBI-3941863	0.37
P68400	Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1)	EBI-5295255	0.44
P36578	60S ribosomal protein L4 (60S ribosomal protein L1) (Large ribosomal subunit protein uL4)	EBI-6262560	0.35
Q14444	Caprin-1 (Cell cycle-associated protein 1) (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored membrane protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule protein 105)	EBI-6262560	0.35
Q9Y2W1	Thyroid hormone receptor-associated protein 3 (BCLAF1 and THRAP3 family member 2) (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150)	EBI-6262560	0.62
P39023	60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) (Large ribosomal subunit protein uL3)	EBI-6262560	0.35
O00571	ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (CAP-Rf) (DEAD box protein 3, X-chromosomal) (DEAD box, X isoform) (DBX) (Helicase-like protein 2) (HLP2)	EBI-6262560	0.60
P62424	60S ribosomal protein L7a (Large ribosomal subunit protein eL8) (PLA-X polypeptide) (Surfeit locus protein 3)	EBI-6262560	0.35
Q02878	60S ribosomal protein L6 (Large ribosomal subunit protein eL6) (Neoplasm-related protein C140) (Tax-responsive enhancer element-binding protein 107) (TaxREB107)	EBI-6262560	0.35
P62753	40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6)	EBI-6262560	0.35
P23396	40S ribosomal protein S3 (EC 4.2.99.18) (Small ribosomal subunit protein uS3)	EBI-6262560	0.35
P62917	60S ribosomal protein L8 (Large ribosomal subunit protein uL2)	EBI-6262560	0.35
P19338	Nucleolin (Protein C23)	EBI-6262560	0.35
Q00839	Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold-attachment factor A) (SAF-A) (p120) (pp120)	EBI-6262560	0.35
P11940	Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1)	EBI-6262659	0.40
Q86VP6	Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1)	EBI-21322532	0.35
Q13616	Cullin-1 (CUL-1)	EBI-21323857	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
P10238	mRNA export factor (Immediate-early protein IE63) (Infected cell protein 27) (ICP27) (VMW63)	EBI-8845500	0.62
Q9Y3Y2	Chromatin target of PRMT1 protein (Friend of PRMT1 protein) (Small arginine- and glycine-rich protein) (SRAG)	EBI-9077975	0.65
Q96QD9	UAP56-interacting factor (Forty-two-three domain-containing protein 1) (Protein 40-2-3)	EBI-9085098	0.35
Q96FV9	THO complex subunit 1 (Tho1) (Nuclear matrix protein p84) (p84N5) (hTREX84)	EBI-9085185	0.35
Q13769	THO complex subunit 5 homolog (Functional spliceosome-associated protein 79) (fSAP79) (NF2/meningioma region protein pK1.3) (Placental protein 39.2) (PP39.2) (hTREX90)	EBI-9085185	0.35
Q8NI27	THO complex subunit 2 (Tho2) (hTREX120)	EBI-9085185	0.35
B4DYC6	cDNA FLJ60958, highly similar to Homo sapiens SGT1, suppressor of G2 allele of SKP1 (SUGT1), mRNA	EBI-9484856	0.40
Q96RS6	NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66)	EBI-9484872	0.40
O95751	Protein LDOC1 (Leucine zipper protein down-regulated in cancer cells)	EBI-10319882	0.67
P14136	Glial fibrillary acidic protein (GFAP)	EBI-10319892	0.78
Q6A162	Keratin, type I cytoskeletal 40 (Cytokeratin-40) (CK-40) (Keratin-40) (K40) (Type I hair keratin Ka36)	EBI-10319926	0.56
Q92997	Segment polarity protein dishevelled homolog DVL-3 (Dishevelled-3) (DSH homolog 3)	EBI-10319936	0.56
Q96CG3	TRAF-interacting protein with FHA domain-containing protein A (Putative MAPK-activating protein PM14) (Putative NF-kappa-B-activating protein 20) (TRAF2-binding protein)	EBI-10319946	0.72
Q9UJV3	Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1)	EBI-10319956	0.56
P17844	Probable ATP-dependent RNA helicase DDX5 (EC 3.6.4.13) (DEAD box protein 5) (RNA helicase p68)	EBI-10096841	0.40
P05412	Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)	EBI-11323169	0.35
P27635	60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM)	EBI-11035646	0.35
Q8VE37	Regulator of chromosome condensation (Chromosome condensation protein 1)	EBI-11043815	0.35
P63280	SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I)	EBI-11044140	0.35
Q68CZ1	Protein fantom (Nephrocystin-8) (RPGR-interacting protein 1-like protein) (RPGRIP1-like protein)	EBI-11368346	0.27
P41219	Peripherin (Neurofilament 4)	EBI-24298299	0.56
O75031	Heat shock factor 2-binding protein	EBI-24498836	0.56
P49639	Homeobox protein Hox-A1 (Homeobox protein Hox-1F)	EBI-24510395	0.56
Q9H079	KATNB1-like protein 1 (Katanin p80 subunit B-like 1)	EBI-24515747	0.56
P49761	Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3)	EBI-24515603	0.56
Q13867	Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40)	EBI-24523474	0.56
P49760	Dual specificity protein kinase CLK2 (EC 2.7.12.1) (CDC-like kinase 2)	EBI-24524233	0.56
Q86WS4	Uncharacterized protein C12orf40	EBI-25264291	0.56
Q9BX10	GTP-binding protein 2	EBI-24622152	0.56
Q9BQ95	Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (Protein SITPEC)	EBI-24628881	0.56
P79522	Proline-rich protein 3 (MHC class I region proline-rich protein CAT56)	EBI-24660575	0.56
P15622	Zinc finger protein 250 (Zinc finger protein 647)	EBI-24661566	0.56
Q9UK41	Vacuolar protein sorting-associated protein 28 homolog (H-Vps28) (ESCRT-I complex subunit VPS28)	EBI-24666279	0.56
Q6ZUT1	Uncharacterized protein NKAPD1 (NKAP domain containing protein 1)	EBI-24668590	0.56
B2RXH4	BTB/POZ domain-containing protein 18	EBI-24673822	0.56
Q6NTE8	MRN complex-interacting protein (MRN-interacting protein)	EBI-24678138	0.56
Q8N6V9	Testis-expressed protein 9	EBI-24680526	0.56
A0A1B0GWI1	Putative coiled-coil domain-containing protein 196	EBI-23711325	0.56
Q5T5B0	Late cornified envelope protein 3E (Late envelope protein 17)	EBI-24686853	0.56
Q9ULR0	Pre-mRNA-splicing factor ISY1 homolog	EBI-24705892	0.56
Q13573	SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein)	EBI-24724810	0.56
O00746	Nucleoside diphosphate kinase, mitochondrial (NDK) (NDP kinase, mitochondrial) (EC 2.7.4.6) (Nucleoside diphosphate kinase D) (NDPKD) (nm23-H4)	EBI-23790873	0.56
Q9BZL4	Protein phosphatase 1 regulatory subunit 12C (Protein phosphatase 1 myosin-binding subunit of 85 kDa) (Protein phosphatase 1 myosin-binding subunit p85)	EBI-24733395	0.56
Q8IZU3	Synaptonemal complex protein 3 (SCP-3)	EBI-24735253	0.56
Q14457	Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]	EBI-24738527	0.56
Q96M83	Coiled-coil domain-containing protein 7 (Protein BIOT2)	EBI-24743255	0.56
Q9NQY0	Bridging integrator 3	EBI-24754052	0.56
Q9H7T9	Aurora kinase A and ninein-interacting protein (AIBp)	EBI-24755679	0.56
Q96DF8	Splicing factor ESS-2 homolog (DiGeorge syndrome critical region 13) (DiGeorge syndrome critical region 14) (DiGeorge syndrome protein H) (DGS-H) (Protein ES2)	EBI-24767131	0.56
Q9NR46	Endophilin-B2 (SH3 domain-containing GRB2-like protein B2)	EBI-24770768	0.56
Q7Z4V0	Zinc finger protein 438	EBI-24778309	0.56
Q5SWW7	Uncharacterized protein C10orf55	EBI-24779073	0.56
Q96P16	Regulation of nuclear pre-mRNA domain-containing protein 1A (Cyclin-dependent kinase inhibitor 2B-related protein) (p15INK4B-related protein)	EBI-24779655	0.56
Q8TDR4	T-complex protein 10A homolog 1 (T-complex protein 10A-1) (TCP10A-1) (TCP10-like)	EBI-24797571	0.56
Q6P1L6	Zinc finger protein 343	EBI-25280752	0.56
Q13555	Calcium/calmodulin-dependent protein kinase type II subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC 2.7.11.17)	EBI-24372650	0.56
A6NEM1	Golgin subfamily A member 6-like protein 9	EBI-24375283	0.56
Q5JR59	Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa)	EBI-24388879	0.56
Q9BYV9	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	EBI-24392545	0.56
Q9UMX0	Ubiquilin-1 (Protein linking IAP with cytoskeleton 1) (PLIC-1) (hPLIC-1)	EBI-24446611	0.56
Q13490	Baculoviral IAP repeat-containing protein 2 (EC 2.3.2.27) (Cellular inhibitor of apoptosis 1) (C-IAP1) (IAP homolog B) (Inhibitor of apoptosis protein 2) (hIAP-2) (hIAP2) (RING finger protein 48) (RING-type E3 ubiquitin transferase BIRC2) (TNFR2-TRAF-signaling complex protein 2)	EBI-24538264	0.56
Q8IZU1	Protein FAM9A	EBI-24539795	0.56
Q8WWB5	PIH1 domain-containing protein 2	EBI-24551261	0.56
Q8N8U2	Chromodomain Y-like protein 2 (CDY-like 2)	EBI-24581617	0.56
Q86WP2	Vasculin (GC-rich promoter-binding protein 1) (Vascular wall-linked protein)	EBI-24598279	0.56
P31321	cAMP-dependent protein kinase type I-beta regulatory subunit	EBI-24598989	0.56
Q9H0A9	Speriolin-like protein (Spermatogenesis and centriole-associated protein 1-like protein)	EBI-24646318	0.56
Q96HB5	Coiled-coil domain-containing protein 120	EBI-24647419	0.56
Q8NCU1	Uncharacterized protein CCDC197 (Coiled-coil domain-containing protein 197)	EBI-24656214	0.56
Q8WWY6	Methyl-CpG-binding domain protein 3-like 1 (MBD3-like protein 1)	EBI-24657169	0.56
Q13829	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (hBACURD2) (BTB/POZ domain-containing protein TNFAIP1) (Protein B12) (Tumor necrosis factor, alpha-induced protein 1, endothelial)	EBI-24777447	0.56
Q8ND83	SLAIN motif-containing protein 1	EBI-25203964	0.56
Q96MP8	BTB/POZ domain-containing protein KCTD7	EBI-24809398	0.56
Q9C0B1	Alpha-ketoglutarate-dependent dioxygenase FTO (Fat mass and obesity-associated protein) (U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO) (EC 1.14.11.-) (U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO) (EC 1.14.11.-) (mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO) (m6A(m)-demethylase FTO) (EC 1.14.11.-) (mRNA N(6)-methyladenosine demethylase FTO) (EC 1.14.11.53) (tRNA N1-methyl adenine demethylase FTO) (EC 1.14.11.-)	EBI-25266832	0.56
Q9P2M4	TBC1 domain family member 14	EBI-25269837	0.56
Q8IVT5	Kinase suppressor of Ras 1 (EC 2.7.11.1)	EBI-14035831	0.35
Q9Y2Z4	Tyrosine--tRNA ligase, mitochondrial (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS)	EBI-21728803	0.35
Q9H000	E3 ubiquitin-protein ligase makorin-2 (EC 2.3.2.27) (RING finger protein 62) (RING-type E3 ubiquitin transferase makorin-2)	EBI-21728803	0.35
Q99666	RANBP2-like and GRIP domain-containing protein 5/6 (Ran-binding protein 2-like 1/2) (RanBP2-like 1/2) (RanBP2L1) (RanBP2L2) (Sperm membrane protein BS-63)	EBI-21728803	0.35
Q53F19	Nuclear cap-binding protein subunit 3 (Protein ELG)	EBI-21728803	0.35
O15354	Prosaposin receptor GPR37 (Endothelin B receptor-like protein 1) (ETBR-LP-1) (G-protein coupled receptor 37) (Parkin-associated endothelin receptor-like receptor) (PAELR)	EBI-21812535	0.35
Q9NPJ8	NTF2-related export protein 2 (Protein p15-2)	EBI-21875490	0.35
Q82506	Non-structural protein 1 (NS1) (NS1A)	EBI-15620563	0.35
Q9BTM9	Ubiquitin-related modifier 1	EBI-15902832	0.35
P03430	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-25769373	0.37
P15659	Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2)	EBI-25769186	0.37
P03427	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-25769439	0.37
P46013	Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67)	EBI-20562326	0.35
O76021	Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1)	EBI-20924306	0.40
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
Q2HR75	mRNA export factor ICP27 homolog (EB2 protein homolog)	EBI-22084769	0.35
P10644	cAMP-dependent protein kinase type I-alpha regulatory subunit (Tissue-specific extinguisher 1) (TSE1)	EBI-25387530	0.35
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-26610537	0.35
Q96KG9	N-terminal kinase-like protein (Coated vesicle-associated kinase of 90 kDa) (SCY1-like protein 1) (Telomerase regulation-associated protein) (Telomerase transcriptional element-interacting factor) (Teratoma-associated tyrosine kinase)	EBI-28944481	0.35
Q13283	Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1)	EBI-28955349	0.35
Q93009	Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7)	EBI-30844801	0.44
A6NLX3	Speedy protein E4	EBI-28997234	0.27
Q9BXK1	Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2)	EBI-29019783	0.35
P30530	Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)	EBI-32719959	0.27
P36888	Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135)	EBI-32722567	0.27

Cross-References

Database	Links
UNIPROT	Q9UBU9 B4E269 Q99799 Q9UQL2
PDB	1FO1 1FT8 1GO5 1JKG 1JN5 1KOH 1KOO 1OAI 2Z5K 2Z5M 3RW6 3RW7 4WYK 6E5U
Pfam	PF02136 PF09162 PF03943
PROSITE	PS51450 PS50177 PS51281
OMIM	602647
DisGeNET	10482

Nuclear RNA export factor 1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 3RW7)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (24 interactors)

Interactions with other proteins (146 interactors)

Cross-References

Database

Links

Description

Description