NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Sorbin and SH3 domain-containing protein 2 - Rattus norvegicus - NucEnvDB

Sorbin and SH3 domain-containing protein 2 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Sorbin and SH3 domain-containing protein 2
Accession Code	O35413
Gene	Sorbs2
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 1196)
MNTDSGGCARKRAAMSVTLTSVKRVQSSPNLLAAGRESHSPDSAWRSYNGRNPETLNGDATYSSLAAKGFRSVRPNLQDKKSPTQSHITINGNSGGAVSPVSYYQRPFSPSAYSLPASLNSSIIMPHGRS LDSAETYSQHAQSLDGTMGSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDEDTDMYNTPYTYNAGLYNSPYSAQSHPAAKTQTYRPLSKSHSDNGTDA FKEATSPVPPPHVPPRPRDQSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPVSVYQSSIDRSLERPSSSASMAGDFRKRRKSEPAVGPPRGLGDHSSSRTSPGRADLPGSSSTFTTSF ISSSPSSPSRAQGGDDSKMCPPLCSYSGLNGSPSSELECCGAYRRHLDVPQDSQRAITFKNGWQMARQNAEIWSSTEEAVSPKIKSRSCDDLLNDDCGSFPDPKTKSESMGSLLCDEGSKESDPMTWTSP YIPEVCGNSRSRLKHRSAHNAPGFLKMYKKMHRINRKDLMNSEVICSVKSRILQYEKEQQHRGLLHGWSQSSTEEVPRDVVPTRISEFEKLIQKSKSMPNLGDEMLSPVTLEPPQNGLCPKRRFSIESLL EEETQVRHPSQGQRSCKSNTLVPIHIEVTSDEQPRTHMEFSDSDQDGVVSDHSDNVHVERSSFCSESDFDHFSFTSSESFYGSSHHHHHHHHHHGHFISSCKGRCPASYTRFTTMLKHERAKHENIDRPR RQDMDPGLSKLAFLVSPVPFRRKKVLTPQKQTEQAKCKASVVEALDSALKDICDQIKAEKRRGSLPDNSILHRLISELLPQIPKRNSSLNALKRSPMHQPFHPLPQDGAIHCPLYQNDCGRMPHSASFPD VDTTSSYHAQDYGSVLSLQDHESPRSYSSTLTDLGRSVSRERRGTPEKEVKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVGIFPISYVEKLTPPEKAQPARPPPPVQPGEIGEAI AKYNFNADTNVELSLRKGDRIILLKRVDQNWYEGKIPGTNRQGIFPVSYVEVVKRNTKGSEDYPDPPLPHSYSSDRIYSLSSNKPQRPVFSHENIQGGGEPFQALYNYTPRNEDELELRESDVVDVMEKC DDGWFVGTSRRTKFFGTFPGNYVKRL

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:10521485, Experimental EvidencePubMed:15128873, Experimental EvidencePubMed:15659545, Experimental EvidencePubMed:16125169}. Apical cell membrane {By SimilarityUniProtKB:O94875}. Cell junction, focal adhesion {By SimilarityUniProtKB:O94875}. Cell projection, lamellipodium {By SimilarityUniProtKB:O94875}. Note=Detected in the stress fibers, synaptosomal cytosol, postsynaptic density fraction, Z-disks and intercalated. The CBL/PTK2B/ARGBP2 complex is recruited to lipid rafts following growth factor stimulation. In pancreatic acinar cells, localized preferentially to the apical membrane. Colocalized with vinculin and filamentous actin at focal adhesions and lamellipodia of pancreatic cells. {By SimilarityUniProtKB:O94875}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Apical Plasma Membrane (GO:0016324) Dendrite (GO:0030425) Focal Adhesion (GO:0005925) Lamellipodium (GO:0030027) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density (GO:0014069) Synapse (GO:0045202)

Biology & Function

Description
Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 (By similarity). May play a role in the regulation of pancreatic cell adhesion, possibly by acting on WASF1 phosphorylation, enhancing phosphorylation by ABL1, as well as dephosphorylation by PTPN12 (By similarity). Isoform 2 increases water and sodium absorption in the intestine and gall-bladder. {By Similarity, By Similarity\|UniProtKB:O94875, Experimental EvidencePubMed:10521485}.
Assigned Ontology terms

Biological Process	Acetylcholine Receptor Signaling Pathway (GO:0095500) Actin Filament Organization (GO:0007015) Cell Growth Involved In Cardiac Muscle Cell Development (GO:0061049) Notch Signaling Pathway (GO:0007219) Regulation Of Skeletal Muscle Acetylcholine-Gated Channel Clustering (GO:1904393)
Molecular Function	Protein Domain Specific Binding (GO:0019904)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q62910	Synaptojanin-1	EBI-7458056	0.40
Interactions with other proteins (7 interactors)

Partner (UniProt)		IntAct	Confidence score
P16086	Spectrin alpha chain, non-erythrocytic 1 (Alpha-II spectrin) (Fodrin alpha chain)	EBI-7458130	0.40
P21575	Dynamin-1 (EC 3.6.5.5) (B-dynamin) (D100) (Dynamin, brain)	EBI-7458357	0.59
P39052	Dynamin-2 (EC 3.6.5.5)	EBI-7458445	0.40
Q9WVJ4	Synaptojanin-2-binding protein (Mitochondrial outer membrane protein 25) (NPW16)	EBI-7458481	0.40
Q5FWU0	Wiskott-Aldrich syndrome protein family member (WASP family protein member)	EBI-7458532	0.40
P49286	Melatonin receptor type 1B (Mel-1B-R) (Mel1b receptor)	EBI-11578506	0.00
Q5XIE8	Integral membrane protein 2B (Immature BRI2) (imBRI2) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]	EBI-26439741	0.35

Cross-References

Database	Links
UNIPROT	O35413 Q923T8
Pfam	PF00018 PF14604 PF02208
PROSITE	PS50002 PS50831

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK