NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Ran GTPase-activating protein 1 - Mus musculus - NucEnvDB

Ran GTPase-activating protein 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ran GTPase-activating protein 1
Accession Code	P46061
Gene	Rangap1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 589)
MASEDIAKLAETLAKTQVAGGQLSFKGKGLKLNTAEDAKDVIKEIEEFDGLEALRLEGNTVGVEAARVIAKALEKKSELK RCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGK ILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGIIGTLEEVHMPQNGINHPGVTALAQAFAINPLLRV INLNDNTFTEKGGVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAVRGGLPKLKELNLSFCEIKRDAALVVAEAVADK AELEKLDLNGNALGEEGCEQLQEVMDSFNMAKVLASLSDDEGEDEDEEEEGEEDDEEEEDEEDEEDDDEEEEEQEEEEEP PQRGSGEEPATPSRKILDPNSGEPAPVLSSPTPTDLSTFLSFPSPEKLLRLGPKVSVLIVQQTDTSDPEKVVSAFLKVAS VFRDDASVKTAVLDAIDALMKKAFSCSSFNSNTFLTRLLIHMGLLKSEDKIKAIPSLHGPLMVLNHVVRQDYFPKALAPL LLAFVTKPNGALETCSFARHNLLQTLYNI

Structure Viewer (PDB: 1KPS)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:26506250, Experimental EvidencePubMed:9442102, Experimental EvidencePubMed:9456312}. Nucleus, nucleoplasm {Experimental EvidencePubMed:26506250}. Nucleus envelope {Experimental EvidencePubMed:16469311, Experimental EvidencePubMed:18305100, Experimental EvidencePubMed:26506250, Experimental EvidencePubMed:9442102, Experimental EvidencePubMed:9456312}. Chromosome, centromere, kinetochore {ECO:0000250\|UniProtKB:P46060}. Cytoplasm, cytoskeleton, spindle {ECO:0000250\|UniProtKB:P46060}. Note=Cytoplasmic during interphase (PubMed:26506250). Detected at the nuclear envelope during interphase (PubMed:9442102, PubMed:9456312, PubMed:26506250). Shuttles between nucleus and cytoplasm (PubMed:26506250). Targeted to the nuclear pores after sumoylation. During mitosis, associates with mitotic spindles, but is essentially not detected at the spindle poles. Association with kinetochores appears soon after nuclear envelope breakdown and persists until late anaphase. Mitotic location also requires sumoylation (By similarity). {ECO:0000250\|UniProtKB:P46060, Experimental EvidencePubMed:26506250, Experimental EvidencePubMed:9442102, Experimental EvidencePubMed:9456312}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Aggresome (GO:0016235) Axon Cytoplasm (GO:1904115) Cytoplasm (GO:0005737) Cytoplasmic Periphery Of The Nuclear Pore Complex (GO:1990723) Cytosol (GO:0005829) Dendrite (GO:0030425) Intracellular Membrane-Bounded Organelle (GO:0043231) Kinetochore (GO:0000776) Mitotic Spindle (GO:0072686) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Pore Cytoplasmic Filaments (GO:0044614) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) SUMO Ligase Complex (GO:0106068)

Biology & Function

Description
GTPase activator for RAN. Converts cytoplasmic GTP-bound RAN to GDP-bound RAN, which is essential for RAN-mediated nuclear import and export (PubMed:18305100). Mediates dissociation of cargo from nuclear export complexes containing XPO1, RAN and RANBP2 after nuclear export (By similarity). Required for postimplantation embryonic development (PubMed:8314081). {By SimilarityUniProtKB:P46060, Experimental EvidencePubMed:18305100, Experimental EvidencePubMed:8314081}.
Assigned Ontology terms

Biological Process	Activation Of GTPase Activity (GO:0090630) Cellular Response To Peptide Hormone Stimulus (GO:0071375) Cellular Response To Vasopressin (GO:1904117) Negative Regulation Of Protein Export From Nucleus (GO:0046826) Nuclear Export (GO:0051168) Nucleocytoplasmic Transport (GO:0006913) Protein Sumoylation (GO:0016925) Response To Axon Injury (GO:0048678) Signal Transduction (GO:0007165)
Molecular Function	GTPase Activator Activity (GO:0005096) RNA Binding (GO:0003723) Small GTPase Binding (GO:0031267) Ubiquitin Protein Ligase Binding (GO:0031625)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P63279	SUMO-conjugating enzyme UBC9	EBI-1033068	0.44
P35922	Fragile X messenger ribonucleoprotein 1	EBI-16728828	0.35
Interactions with other proteins (5 interactors)

Partner (UniProt)		IntAct	Confidence score
Q80Z64	Homeobox protein NANOG (ES cell-associated protein 4) (Early embryo specific expression NK-type homeobox protein) (Homeobox transcription factor Nanog)	EBI-8820601	0.35
P52927	High mobility group protein HMGI-C (High mobility group AT-hook protein 2)	EBI-9986179	0.35
Q61584	RNA-binding protein FXR1 (mFxr1p)	EBI-16729686	0.35
Q9EPK7	Exportin-7 (Exp7) (Ran-binding protein 16)	EBI-17172030	0.35
Q8VI24	DNA-binding protein SATB2 (Special AT-rich sequence-binding protein 2)	EBI-26885104	0.35

Cross-References

Database	Links
UNIPROT	P46061 Q60801 Q6NZB5
PDB	1KPS
Pfam	PF13516 PF07834

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK