NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

ADP-ribosylation factor 3 - Mus musculus - NucEnvDB

ADP-ribosylation factor 3 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	ADP-ribosylation factor 3
Accession Code	P61205
Gene	Arf3
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 181)
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDL PNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK

Subcellular Location

Description
Golgi apparatus {By Similarity}. Cytoplasm, perinuclear region {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Golgi Apparatus (GO:0005794) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Assigned Ontology terms

Biological Process	Intracellular Protein Transport (GO:0006886) Protein Transport (GO:0015031) Retrograde Vesicle-Mediated Transport, Golgi To Endoplasmic Reticulum (GO:0006890) Vesicle-Mediated Transport (GO:0016192)
Molecular Function	GTP Binding (GO:0005525) GTPase Activity (GO:0003924)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P35922	Fragile X messenger ribonucleoprotein 1	EBI-16728828	0.35
Q7TMB8	Cytoplasmic FMR1-interacting protein 1	EBI-16727444	0.35
Interactions with other proteins (5 interactors)

Partner (UniProt)		IntAct	Confidence score
Q62108	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	EBI-16724752	0.53
F6SEU4	Ras/Rap GTPase-activating protein SynGAP (Neuronal RasGAP) (Synaptic Ras GTPase-activating protein 1) (Synaptic Ras-GAP 1)	EBI-16733301	0.53
Q9D415	Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1)	EBI-16725590	0.35
Q4ACU6	SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) (SPANK-2)	EBI-16726570	0.35
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-26612017	0.35

Cross-References

Database	Links
UNIPROT	P61205 P16587
Pfam	PF00025
PROSITE	PS51417

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK