Protein Information |
|
|---|---|
| Protein Name | Cytoplasmic FMR1-interacting protein 1 |
| Accession Code | Q7TMB8 |
| Gene | Cyfip1 |
| Organism | Mus musculus | House mouse (Taxonomy: 10090) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1253) | |
|
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQR NAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEK HMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCASSSSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKL FDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCD WETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTD HILETKEASMMEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL ELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVG PPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVCDLLHAAPFQNILPRIHVKEG ERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRTFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQ QRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGESTPVEHVRCFQPPIHQSLASS |
|
Interactions with Nuclear Envelope proteins (10 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O08788 | Dynactin subunit 1 | EBI-16727444 | 0.35 |
| P15209 | BDNF/NT-3 growth factors receptor | EBI-16727444 | 0.35 |
| P16054 | Protein kinase C epsilon type | EBI-16727444 | 0.35 |
| P35922 | Fragile X messenger ribonucleoprotein 1 | EBI-2000004 | 0.58 |
| P63318 | Protein kinase C gamma type | EBI-16727444 | 0.35 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-3649150 | 0.37 |
| Q5SQX6 | Cytoplasmic FMR1-interacting protein 2 | EBI-16727444 | 0.35 |
| Q6ZPE2 | Myotubularin-related protein 5 | EBI-16727444 | 0.35 |
| Q8CHG7 | Rap guanine nucleotide exchange factor 2 | EBI-16727444 | 0.35 |
| P61205 | ADP-ribosylation factor 3 | EBI-16727444 | 0.35 | Interactions with other proteins (115 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P62158 | Calmodulin-1 | EBI-911456 | 0.35 |
| P63073 | Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa subunit) | EBI-2000004 | 0.63 |
| O55135 | Eukaryotic translation initiation factor 6 (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP)) | EBI-2000004 | 0.40 |
| P62754 | 40S ribosomal protein S6 (Phosphoprotein NP33) | EBI-2000004 | 0.40 |
| Q8BM65 | Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2 | EBI-7448021 | 0.35 |
| P26450 | Phosphatidylinositol 3-kinase regulatory subunit alpha (PI3-kinase regulatory subunit alpha) (PI3K regulatory subunit alpha) (PtdIns-3-kinase regulatory subunit alpha) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha) (PI3-kinase subunit p85-alpha) (PtdIns-3-kinase regulatory subunit p85-alpha) | EBI-7448114 | 0.46 |
| Q8R5H6 | Actin-binding protein WASF1 (Protein WAVE-1) (Wiskott-Aldrich syndrome protein family member 1) (WASP family protein member 1) | EBI-7448095 | 0.53 |
| Q5DU14 | Unconventional myosin-XVI (Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3) (Unconventional myosin-16) | EBI-7448718 | 0.35 |
| Q80TE2 | MKIAA1400 protein | EBI-9214306 | 0.35 |
| Q6ZPJ3 | (E3-independent) E2 ubiquitin-conjugating enzyme UBE2O (EC 2.3.2.24) (E2/E3 hybrid ubiquitin-protein ligase UBE2O) (Ubiquitin carrier protein O) (Ubiquitin-conjugating enzyme E2 O) (Ubiquitin-conjugating enzyme E2 of 230 kDa) (Ubiquitin-conjugating enzyme E2-230K) (Ubiquitin-protein ligase O) | EBI-16727444 | 0.35 |
| Q8C7R4 | Ubiquitin-like modifier-activating enzyme 6 (Ubiquitin-activating enzyme 6) (EC 6.2.1.45) (Ubiquitin-activating enzyme E1-like protein 2) (E1-L2) | EBI-16727444 | 0.35 |
| Q9QUQ5 | Short transient receptor potential channel 4 (TrpC4) (Capacitative calcium entry channel Trp4) (Receptor-activated cation channel TRP4) | EBI-16727444 | 0.35 |
| Q9CQE1 | Protein NipSnap homolog 3B (NipSnap3B) (NipSnap-related protein) (Protein NipSnap homolog 3A) (NipSnap3A) | EBI-16727444 | 0.35 |
| P61358 | 60S ribosomal protein L27 | EBI-16727444 | 0.35 |
| Q62159 | Rho-related GTP-binding protein RhoC (Silica-induced gene 61 protein) (SIG-61) | EBI-16727444 | 0.35 |
| Q921J2 | GTP-binding protein Rheb (Ras homolog enriched in brain) | EBI-16727444 | 0.35 |
| O35239 | Tyrosine-protein phosphatase non-receptor type 9 (EC 3.1.3.48) (Protein-tyrosine phosphatase MEG2) (PTPase MEG2) | EBI-16727444 | 0.35 |
| P48437 | Prospero homeobox protein 1 (Homeobox prospero-like protein PROX1) (PROX-1) | EBI-16727444 | 0.35 |
| Q8C167 | Prolyl endopeptidase-like (EC 3.4.21.-) (Prolylendopeptidase-like) | EBI-16727444 | 0.35 |
| Q80U63 | Mitofusin-2 (EC 3.6.5.-) (Hypertension-related protein 1) (Mitochondrial assembly regulatory factor) (HSG protein) (Transmembrane GTPase MFN2) | EBI-16727444 | 0.35 |
| Q03717 | Potassium voltage-gated channel subfamily B member 1 (Voltage-gated potassium channel subunit Kv2.1) (mShab) | EBI-16727444 | 0.35 |
| Q8VI75 | Importin-4 (Imp4) (Importin-4a) (Imp4a) (Ran-binding protein 4) (RanBP4) | EBI-16727444 | 0.35 |
| P24547 | Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (IMPDH-II) | EBI-16727444 | 0.35 |
| Q9R0I7 | YLP motif-containing protein 1 (Nuclear protein ZAP3) | EBI-16727444 | 0.35 |
| Q9R1R2 | Tripartite motif-containing protein 3 (RING finger protein 22) (RING finger protein HAC1) | EBI-16727444 | 0.35 |
| O55013 | Trafficking protein particle complex subunit 3 (BET3 homolog) | EBI-16727444 | 0.35 |
| Q9CYZ2 | Tumor protein D54 (Tumor protein D52-like 2) | EBI-16727444 | 0.35 |
| B2RWJ3 | Transmembrane protein 240 | EBI-16727444 | 0.35 |
| Q8CC35 | Synaptopodin | EBI-16727444 | 0.35 |
| F6SEU4 | Ras/Rap GTPase-activating protein SynGAP (Neuronal RasGAP) (Synaptic Ras GTPase-activating protein 1) (Synaptic Ras-GAP 1) | EBI-16727444 | 0.53 |
| Q68FG2 | Spectrin beta chain | EBI-16727444 | 0.35 |
| Q62261 | Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Embryonic liver fodrin) (Fodrin beta chain) | EBI-16727444 | 0.35 |
| P16546 | Spectrin alpha chain, non-erythrocytic 1 (Alpha-II spectrin) (Fodrin alpha chain) | EBI-16727444 | 0.35 |
| Q61548 | Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20) | EBI-16727444 | 0.35 |
| Q8JZR6 | Electroneutral sodium bicarbonate exchanger 1 (Electroneutral Na+-driven Cl-HCO3 exchanger) (Solute carrier family 4 member 8) (k-NBC3) | EBI-16727444 | 0.35 |
| Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) (SPANK-2) | EBI-16727444 | 0.35 |
| D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 (Shank1) | EBI-16727444 | 0.35 |
| Q8VD37 | SH3-containing GRB2-like protein 3-interacting protein 1 (Endophilin-3-interacting protein) | EBI-16727444 | 0.35 |
| Q8K0T0 | Reticulon-1 (Neuroendocrine-specific protein) | EBI-16727444 | 0.35 |
| Q8BSK8 | Ribosomal protein S6 kinase beta-1 (S6K-beta-1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70-S6K 1) (Ribosomal protein S6 kinase I) (S6K) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (p70 S6K-alpha) (p70 S6KA) | EBI-16727444 | 0.35 |
| P63001 | Ras-related C3 botulinum toxin substrate 1 (EC 3.6.5.2) (p21-Rac1) | EBI-16727444 | 0.35 |
| P68404 | Protein kinase C beta type (PKC-B) (PKC-beta) (EC 2.7.11.13) | EBI-16727444 | 0.35 |
| P63087 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-16727444 | 0.35 |
| Q7M6Y3 | Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia) (CALM) | EBI-16727444 | 0.35 |
| E9Q3L2 | Phosphatidylinositol 4-kinase alpha (PI4-kinase alpha) (PI4K-alpha) (PtdIns-4-kinase alpha) (EC 2.7.1.67) | EBI-16727444 | 0.35 |
| Q2M3X8 | Phosphatase and actin regulator 1 | EBI-16727444 | 0.35 |
| O89084 | cAMP-specific 3',5'-cyclic phosphodiesterase 4A (EC 3.1.4.53) | EBI-16727444 | 0.35 |
| Q9WU78 | Programmed cell death 6-interacting protein (ALG-2-interacting protein 1) (ALG-2-interacting protein X) (E2F1-inducible protein) (Eig2) | EBI-16727444 | 0.35 |
| O88643 | Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (CDC42/RAC effector kinase PAK-A) (p21-activated kinase 1) (PAK-1) (p65-PAK) | EBI-16727444 | 0.35 |
| Q9Z1M0 | P2X purinoceptor 7 (P2X7) (ATP receptor) (P2Z receptor) (Purinergic receptor) | EBI-16727444 | 0.35 |
| P58281 | Dynamin-like 120 kDa protein, mitochondrial (EC 3.6.5.5) (Large GTP-binding protein) (LargeG) (Optic atrophy protein 1 homolog) [Cleaved into: Dynamin-like 120 kDa protein, form S1] | EBI-16727444 | 0.35 |
| O08919 | Numb-like protein | EBI-16727444 | 0.35 |
| P46460 | Vesicle-fusing ATPase (EC 3.6.4.6) (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) (Suppressor of K(+) transport growth defect 2) (Protein SKD2) (Vesicular-fusion protein NSF) | EBI-16727444 | 0.35 |
| Q11011 | Puromycin-sensitive aminopeptidase (PSA) (EC 3.4.11.14) (Cytosol alanyl aminopeptidase) (AAP-S) | EBI-16727444 | 0.35 |
| P08553 | Neurofilament medium polypeptide (NF-M) (160 kDa neurofilament protein) (Neurofilament 3) (Neurofilament triplet M protein) | EBI-16727444 | 0.35 |
| P08551 | Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein) | EBI-16727444 | 0.35 |
| P19246 | Neurofilament heavy polypeptide (NF-H) (200 kDa neurofilament protein) (Neurofilament triplet H protein) | EBI-16727444 | 0.35 |
| P28660 | Nck-associated protein 1 (NAP 1) (Brain protein H19) (MH19) (Membrane-associated protein HEM-2) (p125Nap1) | EBI-16727444 | 0.35 |
| Q9Z0E0 | Neurochondrin (M-Sema F-associating protein of 75 kDa) (Norbin) | EBI-16727444 | 0.35 |
| P55066 | Neurocan core protein (Chondroitin sulfate proteoglycan 3) | EBI-16727444 | 0.35 |
| Q99104 | Unconventional myosin-Va (Dilute myosin heavy chain, non-muscle) | EBI-16727444 | 0.35 |
| Q8K310 | Matrin-3 | EBI-16727444 | 0.35 |
| Q9QXZ0 | Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 (Actin cross-linking family 7) | EBI-16727444 | 0.35 |
| Q8BHA1 | Leucine-rich repeat-containing protein 24 | EBI-16727444 | 0.35 |
| P28740 | Kinesin-like protein KIF2A (Kinesin-2) | EBI-16727444 | 0.35 |
| Q8R0S2 | IQ motif and SEC7 domain-containing protein 1 | EBI-16727444 | 0.35 |
| P35436 | Glutamate receptor ionotropic, NMDA 2A (GluN2A) (Glutamate [NMDA] receptor subunit epsilon-1) (N-methyl D-aspartate receptor subtype 2A) (NMDAR2A) (NR2A) | EBI-16727444 | 0.35 |
| Q921M4 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) | EBI-16727444 | 0.35 |
| P15105 | Glutamine synthetase (GS) (EC 6.3.1.2) (Glutamate--ammonia ligase) (Palmitoyltransferase GLUL) (EC 2.3.1.225) | EBI-16727444 | 0.35 |
| Q8K1B8 | Fermitin family homolog 3 (Kindlin-3) (Unc-112-related protein 2) | EBI-16727444 | 0.35 |
| F8VPU2 | FERM, ARHGEF and pleckstrin domain-containing protein 1 (FERM, RhoGEF and pleckstrin domain-containing protein 1) | EBI-16727444 | 0.35 |
| Q8BWY3 | Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) | EBI-16727444 | 0.35 |
| Q6PH08 | ERC protein 2 (CAZ-associated structural protein 1) (CAST1) | EBI-16727444 | 0.35 |
| Q9WV92 | Band 4.1-like protein 3 (4.1B) (Differentially expressed in adenocarcinoma of the lung protein 1) (DAL-1) (DAL1P) (mDAL-1) (Erythrocyte membrane protein band 4.1-like 3) [Cleaved into: Band 4.1-like protein 3, N-terminally processed] | EBI-16727444 | 0.35 |
| Q9Z2H5 | Band 4.1-like protein 1 (Erythrocyte membrane protein band 4.1-like 1) (Neuronal protein 4.1) (4.1N) | EBI-16727444 | 0.35 |
| P62631 | Elongation factor 1-alpha 2 (EF-1-alpha-2) (Eukaryotic elongation factor 1 A-2) (eEF1A-2) (Statin-S1) | EBI-16727444 | 0.35 |
| Q9JHU4 | Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic) | EBI-16727444 | 0.35 |
| Q9R0P5 | Destrin (Actin-depolymerizing factor) (ADF) (Sid 23) | EBI-16727444 | 0.35 |
| O35098 | Dihydropyrimidinase-related protein 4 (DRP-4) (Collapsin response mediator protein 3) (CRMP-3) (UNC33-like phosphoprotein 4) (ULIP-4) | EBI-16727444 | 0.35 |
| O08553 | Dihydropyrimidinase-related protein 2 (DRP-2) (Unc-33-like phosphoprotein 2) (ULIP-2) | EBI-16727444 | 0.35 |
| Q8BZ98 | Dynamin-3 (EC 3.6.5.5) | EBI-16727444 | 0.35 |
| P39054 | Dynamin-2 (EC 3.6.5.5) (Dynamin UDNM) | EBI-16727444 | 0.35 |
| Q8K1M6 | Dynamin-1-like protein (EC 3.6.5.5) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-related protein 1) | EBI-16727444 | 0.35 |
| P39053 | Dynamin-1 (EC 3.6.5.5) | EBI-16727444 | 0.35 |
| Q80TZ3 | Putative tyrosine-protein phosphatase auxilin (EC 3.1.3.48) (DnaJ homolog subfamily C member 6) | EBI-16727444 | 0.35 |
| Q62108 | Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90) | EBI-16727444 | 0.35 |
| Q91XM9 | Disks large homolog 2 (Channel-associated protein of synapse-110) (Chapsyn-110) (Postsynaptic density protein PSD-93) | EBI-16727444 | 0.35 |
| Q9JLM8 | Serine/threonine-protein kinase DCLK1 (EC 2.7.11.1) (Doublecortin-like and CAM kinase-like 1) (Doublecortin-like kinase 1) | EBI-16727444 | 0.35 |
| Q9QXS6 | Drebrin (Developmentally-regulated brain protein) | EBI-16727444 | 0.35 |
| Q9JLV5 | Cullin-3 (CUL-3) | EBI-16727444 | 0.35 |
| P97427 | Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3) | EBI-16727444 | 0.35 |
| O54991 | Contactin-associated protein 1 (Caspr) (Caspr1) (MHDNIV) (NCP1) (Neurexin IV) (Neurexin-4) (Paranodin) | EBI-16727444 | 0.35 |
| P80318 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (Matricin) (mTRiC-P5) | EBI-16727444 | 0.35 |
| P47754 | F-actin-capping protein subunit alpha-2 (CapZ alpha-2) | EBI-16727444 | 0.35 |
| Q3UHL1 | CaM kinase-like vesicle-associated protein | EBI-16727444 | 0.35 |
| P28652 | Calcium/calmodulin-dependent protein kinase type II subunit beta (CaM kinase II subunit beta) (CaMK-II subunit beta) (EC 2.7.11.17) | EBI-16727444 | 0.35 |
| P11798 | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17) | EBI-16727444 | 0.35 |
| Q8BKX1 | Brain-specific angiogenesis inhibitor 1-associated protein 2 (BAI-associated protein 2) (BAI1-associated protein 2) (Insulin receptor substrate protein of 53 kDa) (IRSp53) (Insulin receptor substrate p53) (Insulin receptor tyrosine kinase 53 kDa substrate) | EBI-16727444 | 0.35 |
| P59999 | Actin-related protein 2/3 complex subunit 4 (Arp2/3 complex 20 kDa subunit) (p20-ARC) | EBI-16727444 | 0.35 |
| Q60875 | Rho guanine nucleotide exchange factor 2 (Guanine nucleotide exchange factor H1) (GEF-H1) (LBC'S first cousin) (Lymphoid blast crisis-like 1) (Oncogene LFC) (Rhobin) | EBI-16727444 | 0.35 |
| Q9DBG3 | AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) | EBI-16727444 | 0.35 |
| P17426 | AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit) | EBI-16727444 | 0.35 |
| P61967 | AP-1 complex subunit sigma-1A (Adaptor protein complex AP-1 subunit sigma-1A) (Adaptor-related protein complex 1 subunit sigma-1A) (Clathrin assembly protein complex 1 sigma-1A small chain) (Clathrin coat assembly protein AP19) (Golgi adaptor HA1/AP1 adaptin sigma-1A subunit) (HA1 19 kDa subunit) (Sigma 1a subunit of AP-1 clathrin) (Sigma-adaptin 1A) (Sigma1A-adaptin) | EBI-16727444 | 0.35 |
| O35643 | AP-1 complex subunit beta-1 (Adaptor protein complex AP-1 subunit beta-1) (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit) | EBI-16727444 | 0.35 |
| Q99NH0 | Ankyrin repeat domain-containing protein 17 (Ankyrin repeat domain-containing protein FOE) (Gene trap ankyrin repeat protein) | EBI-16727444 | 0.35 |
| Q8C8R3 | Ankyrin-2 (ANK-2) (Ankyrin-B) (Brain ankyrin) | EBI-16727444 | 0.35 |
| Q3UHD9 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 (AGAP-2) (Centaurin-gamma-1) (Cnt-g1) (Phosphatidylinositol 3-kinase enhancer) (PIKE) | EBI-16727444 | 0.53 |
| P60710 | Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-16727444 | 0.35 |
| Q8CBW3 | Abl interactor 1 (Abelson interactor 1) (Abi-1) (Ablphilin-1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Spectrin SH3 domain-binding protein 1) (e3B1) | EBI-16727444 | 0.35 |
| Q3UHJ0 | AP2-associated protein kinase 1 (EC 2.7.11.1) (Adaptor-associated kinase 1) | EBI-16727444 | 0.35 |
| Q9WV60 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | EBI-16727444 | 0.35 |
| Q9QYS2 | Metabotropic glutamate receptor 3 (mGluR3) | EBI-16727444 | 0.35 |
| P83510 | Traf2 and NCK-interacting protein kinase (EC 2.7.11.1) | EBI-16734044 | 0.35 |
| Q9EP53 | Hamartin (Tuberous sclerosis 1 protein homolog) | EBI-16734894 | 0.35 |
| Q9D415 | Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1) | EBI-16725590 | 0.35 |
Database | Links |
| UNIPROT | Q7TMB8 O88558 Q3U7Q7 Q5DU50 Q7TSZ5 Q80VN6 Q8CE85 Q99LY1 |
| Pfam | PF07159 PF05994 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory