Clathrin interactor 1 - Homo sapiens

Clathrin interactor 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Clathrin interactor 1
Accession Code	Q14677
Gene	CLINT1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 625)
MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVY KSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYV GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKA RRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSS KSSGDLVDLFDGTSQSTGGSADLFGGFADFGSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPA VELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDP SVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGT MGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK

Structure Viewer (PDB: 1XGW)

Subcellular Location

Description
Cytoplasm. Cytoplasm, perinuclear region. Membrane; Peripheral membrane protein. Cytoplasmic vesicle, clathrin- coated vesicle. Note=Found throughout the cell, with the exception of the cell surface. Concentrated in the perinuclear region and associated with clathrin-coated vesicles close to the trans-Golgi network.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Clathrin Vesicle Coat (GO:0030125) Cytosol (GO:0005829) Endosome (GO:0005768) Golgi Apparatus (GO:0005794) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Nucleoplasm (GO:0005654) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Binds to membranes enriched in phosphatidylinositol 4,5- bisphosphate (PtdIns(4,5)P2). May have a role in transport via clathrin-coated vesicles from the trans-Golgi network to endosomes. Stimulates clathrin assembly. {Experimental EvidencePubMed:12429846, Experimental EvidencePubMed:12538641}.
Assigned Ontology terms

Biological Process	Endocytosis (GO:0006897)
Molecular Function	Cadherin Binding (GO:0045296) Clathrin Binding (GO:0030276) Phospholipid Binding (GO:0005543)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O14976	Cyclin-G-associated kinase	EBI-11150908	0.35
O15027	Protein transport protein Sec16A	EBI-11083608	0.35
Q8WTR4	Glycerophosphodiester phosphodiesterase domain-containing protein 5	EBI-16430940	0.56
P22892	AP-1 complex subunit gamma-1	EBI-7071326	0.54
Interactions with other proteins (126 interactors)

Partner (UniProt)		IntAct	Confidence score
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-1171360	0.35
Q68FD5	Clathrin heavy chain 1	EBI-7071372	0.40
Q96FJ0	AMSH-like protease (AMSH-LP) (EC 3.4.19.-) (STAM-binding protein-like 1)	EBI-2511015	0.40
O95630	STAM-binding protein (EC 3.4.19.-) (Associated molecule with the SH3 domain of STAM) (Endosome-associated ubiquitin isopeptidase)	EBI-2511053	0.40
Q9BXB5	Oxysterol-binding protein-related protein 10 (ORP-10) (OSBP-related protein 10)	EBI-2514827	0.40
Q9JLQ0	CD2-associated protein (Mesenchyme-to-epithelium transition protein with SH3 domains 1) (METS-1)	EBI-2563436	0.40
A0A5P8YCG4	Probable outer membrane efflux lipoprotein	EBI-2847836	0.00
A0A5P8YJZ1	Putative stringent starvation protein A	EBI-2870530	0.00
Q8CKM1	Calcium-binding protein	EBI-2870523	0.00
Q8ZD27	tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I)	EBI-2870516	0.00
A0A5P8YBI5	Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)	EBI-2870542	0.00
Q8ZDX4	Vitamin B12 import system permease protein BtuC	EBI-2870549	0.00
Q99459	Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein)	EBI-7954144	0.35
O95166	Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46)	EBI-2946896	0.44
Q9H0R8	Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1)	EBI-2947275	0.52
P60520	Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein)	EBI-2947563	0.44
Q9GZQ8	Microtubule-associated proteins 1A/1B light chain 3B (Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta)	EBI-2947914	0.52
Q9BXW4	Microtubule-associated proteins 1A/1B light chain 3C (Autophagy-related protein LC3 C) (Autophagy-related ubiquitin-like modifier LC3 C) (MAP1 light chain 3-like protein 3) (MAP1A/MAP1B light chain 3 C) (MAP1A/MAP1B LC3 C) (Microtubule-associated protein 1 light chain 3 gamma)	EBI-2948265	0.44
Q9H492	Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha)	EBI-3044058	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
Q9NQW6	Anillin	EBI-11009421	0.35
Q91X51	Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65)	EBI-11015786	0.35
Q99JI4	26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit RPN7) (26S proteasome regulatory subunit S10) (p42A)	EBI-11026623	0.35
Q92734	Protein TFG (TRK-fused gene protein)	EBI-11029015	0.35
Q92614	Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210)	EBI-11030093	0.35
Q96H55	Unconventional myosin-XIX (Myosin head domain-containing protein 1)	EBI-11031416	0.35
O75787	Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment]	EBI-11037152	0.35
P56377	AP-1 complex subunit sigma-2 (Adaptor protein complex AP-1 subunit sigma-1B) (Adaptor-related protein complex 1 subunit sigma-1B) (Clathrin assembly protein complex 1 sigma-1B small chain) (Golgi adaptor HA1/AP1 adaptin sigma-1B subunit) (Sigma 1B subunit of AP-1 clathrin) (Sigma-adaptin 1B) (Sigma1B-adaptin)	EBI-11037753	0.35
P21333	Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin)	EBI-11038784	0.35
Q61879	Myosin-10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non-muscle IIb) (Non-muscle myosin heavy chain B) (NMMHC-B) (Non-muscle myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB)	EBI-11041929	0.35
P60710	Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed]	EBI-11045267	0.35
P51148	Ras-related protein Rab-5C (EC 3.6.5.2) (L1880) (RAB5L)	EBI-11046231	0.35
P63167	Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)	EBI-12449761	0.51
Q91YN9	BAG family molecular chaperone regulator 2 (BAG-2) (Bcl-2-associated athanogene 2)	EBI-11052510	0.35
Q9UHB6	LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm)	EBI-11058729	0.35
Q9D6P8	Calmodulin-like protein 3	EBI-11062262	0.35
G3X972	Sec24-related gene family, member C (S. cerevisiae)	EBI-11079358	0.35
Q91VZ6	Stromal membrane-associated protein 1	EBI-11079957	0.35
Q16643	Drebrin (Developmentally-regulated brain protein)	EBI-11080402	0.35
P09497	Clathrin light chain B (Lcb)	EBI-11081190	0.35
Q9NYZ3	G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog)	EBI-11081743	0.35
Q13492	Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein)	EBI-11082344	0.35
Q00610	Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17)	EBI-11082478	0.35
Q8N3V7	Synaptopodin	EBI-11086992	0.35
P13541	Myosin-3 (Myosin heavy chain 3)	EBI-11092646	0.35
Q8VDD5	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11092730	0.35
Q9WTI7	Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb)	EBI-11093786	0.35
P12883	Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain, cardiac muscle beta isoform) (MyHC-beta)	EBI-11098156	0.35
P35579	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11098811	0.35
Q96QS3	Homeobox protein ARX (Aristaless-related homeobox)	EBI-11107478	0.35
P16333	Cytoplasmic protein NCK1 (NCK adaptor protein 1) (Nck-1) (SH2/SH3 adaptor protein NCK-alpha)	EBI-11108107	0.35
Q9Z1Z0	General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein)	EBI-11110688	0.35
P47755	F-actin-capping protein subunit alpha-2 (CapZ alpha-2)	EBI-11117728	0.35
Q6ZNC8	Lysophospholipid acyltransferase 1 (LPLAT 1) (1-acylglycerophosphocholine O-acyltransferase) (EC 2.3.1.23) (1-acylglycerophosphoethanolamine O-acyltransferase) (EC 2.3.1.n7) (1-acylglycerophosphoserine O-acyltransferase MBOAT1) (EC 2.3.1.n6) (Lysophosphatidylserine acyltransferase) (LPSAT) (Lyso-PS acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 1) (O-acyltransferase domain-containing protein 1)	EBI-11121915	0.35
P46940	Ras GTPase-activating-like protein IQGAP1 (p195)	EBI-11132927	0.35
Q99615	DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2)	EBI-11136121	0.35
P62140	Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53)	EBI-11142496	0.35
Q5BJF6	Outer dense fiber protein 2 (Cenexin) (Outer dense fiber of sperm tails protein 2)	EBI-11367291	0.27
Q86X19	Transmembrane protein 17	EBI-11372615	0.27
Q9P0N5	Transmembrane protein 216	EBI-11398030	0.27
Q6P5F9	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-11603310	0.35
Q96FJ2	Dynein light chain 2, cytoplasmic (8 kDa dynein light chain b) (DLC8b) (Dynein light chain LC8-type 2)	EBI-12449804	0.51
P03431	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-12579531	0.35
P03428	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-12579909	0.35
I6T1Z2	Non-structural protein 1 (NS1)	EBI-12581451	0.35
Q5EP37	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-12582677	0.35
C5E526	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-12584689	0.35
Q1K9H5	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-12588354	0.35
B4URF7	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-12588729	0.35
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
Q96CW1	AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein)	EBI-21520588	0.35
O75379	Vesicle-associated membrane protein 4 (VAMP-4)	EBI-21524155	0.35
Q9UEU0	Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1)	EBI-21525256	0.35
Q9UNK0	Syntaxin-8	EBI-21615189	0.35
Q9NSY1	BMP-2-inducible protein kinase (BIKe) (EC 2.7.11.1)	EBI-21615189	0.35
Q9H0L4	Cleavage stimulation factor subunit 2 tau variant (CF-1 64 kDa subunit tau variant) (Cleavage stimulation factor 64 kDa subunit tau variant) (CSTF 64 kDa subunit tau variant) (TauCstF-64)	EBI-21615189	0.35
Q96D71	RalBP1-associated Eps domain-containing protein 1 (RalBP1-interacting protein 1)	EBI-21615189	0.35
Q8WXE9	Stonin-2 (Stoned B)	EBI-21615189	0.35
Q8WU79	Stromal membrane-associated protein 2 (Stromal membrane-associated protein 1-like)	EBI-21615189	0.35
Q15311	RalA-binding protein 1 (RalBP1) (76 kDa Ral-interacting protein) (Dinitrophenyl S-glutathione ATPase) (DNP-SG ATPase) (EC 7.6.2.2, EC 7.6.2.3) (Ral-interacting protein 1)	EBI-21615189	0.35
Q10567	AP-1 complex subunit beta-1 (Adaptor protein complex AP-1 subunit beta-1) (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit)	EBI-21615189	0.35
P53675	Clathrin heavy chain 2 (Clathrin heavy chain on chromosome 22) (CLH-22)	EBI-21615189	0.35
O95782	AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)	EBI-21615189	0.35
O94973	AP-2 complex subunit alpha-2 (100 kDa coated vesicle protein C) (Adaptor protein complex AP-2 subunit alpha-2) (Adaptor-related protein complex 2 subunit alpha-2) (Alpha-adaptin C) (Alpha2-adaptin) (Clathrin assembly protein complex 2 alpha-C large chain) (Huntingtin yeast partner J) (Huntingtin-interacting protein 9) (HIP-9) (Huntingtin-interacting protein J) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit)	EBI-21615189	0.35
O00443	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha (PI3K-C2-alpha) (PtdIns-3-kinase C2 subunit alpha) (EC 2.7.1.137) (EC 2.7.1.153) (EC 2.7.1.154) (Phosphoinositide 3-kinase-C2-alpha)	EBI-21615189	0.35
B9A025	Lysyl oxidase homolog (EC 1.4.3.13)	EBI-21615189	0.35
Q9UJ41	Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5)	EBI-21644136	0.35
Q96T17	MAP7 domain-containing protein 2	EBI-21796065	0.35
Q9UJY4	ADP-ribosylation factor-binding protein GGA2 (Gamma-adaptin-related protein 2) (Golgi-localized, gamma ear-containing, ARF-binding protein 2) (VHS domain and ear domain of gamma-adaptin) (Vear)	EBI-21886169	0.35
O88384	Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1)	EBI-15671994	0.65
Q01968	Inositol polyphosphate 5-phosphatase OCRL (EC 3.1.3.36) (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase OCRL-1) (OCRL-1) (Lowe oculocerebrorenal syndrome protein) (Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase) (EC 3.1.3.86)	EBI-16412089	0.35
Q14684	Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B)	EBI-16686997	0.35
O15155	BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18)	EBI-16788067	0.27
P11279	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	EBI-16794808	0.27
O43493	Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2)	EBI-16800265	0.42
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q5T7N2	LINE-1 type transposase domain-containing protein 1 (ES cell-associated protein 11)	EBI-20993270	0.35
Q9NPJ6	Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36)	EBI-25472202	0.27
Q9Y586	Protein mab-21-like 2	EBI-21261050	0.35
G3V2R1	Protein Smaug homolog 1 (Sterile alpha motif domain containing 4A, isoform CRA_a)	EBI-21264254	0.35
O84226	IncA protein	EBI-22302652	0.40
Q9C0B5	Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375)	EBI-25636144	0.35
O76024	Wolframin	EBI-25897869	0.56
O60333	Kinesin-like protein KIF1B (Klp)	EBI-25915115	0.56
O43464	Serine protease HTRA2, mitochondrial (EC 3.4.21.108) (High temperature requirement protein A2) (HtrA2) (Omi stress-regulated endoprotease) (Serine protease 25) (Serine proteinase OMI)	EBI-27050249	0.35
Q96LU5	Mitochondrial inner membrane protease subunit 1 (EC 3.4.21.-) (IMP1-like protein)	EBI-27050332	0.35
Q96T52	Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein)	EBI-27050444	0.35
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
A0A0H3NFP4	SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity)	EBI-27055788	0.27
A0A0H3NB75	Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV)	EBI-27055983	0.27
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27108918	0.35
Q99592	Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171)	EBI-27093179	0.35
P80192	Mitogen-activated protein kinase kinase kinase 9 (EC 2.7.11.25) (Mixed lineage kinase 1)	EBI-28938802	0.35
Q5TCX8	Mitogen-activated protein kinase kinase kinase 21 (EC 2.7.11.25) (Mitogen-activated protein kinase kinase kinase MLK4) (Mixed lineage kinase 4)	EBI-28941668	0.35
Q9BYP7	Serine/threonine-protein kinase WNK3 (EC 2.7.11.1) (Protein kinase lysine-deficient 3) (Protein kinase with no lysine 3)	EBI-28946054	0.35
Q9H3S7	Tyrosine-protein phosphatase non-receptor type 23 (EC 3.1.3.48) (His domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14)	EBI-27114830	0.35
Q9Y6R9	Centrosomal protein CCDC61 (Coiled-coil domain-containing protein 61) (VFL3 homolog)	EBI-27132749	0.35
P63010	AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit)	EBI-30816421	0.44
P54756	Ephrin type-A receptor 5 (EC 2.7.10.1) (Brain-specific kinase) (EPH homology kinase 1) (EHK-1) (EPH-like kinase 7) (EK7) (hEK7)	EBI-32720907	0.27
Q15375	Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11)	EBI-32721052	0.27
P11362	Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)	EBI-32721578	0.27
P21802	Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)	EBI-32721907	0.27
P22455	Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)	EBI-32722168	0.27
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32724526	0.27
P07949	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]	EBI-32725031	0.27
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-34581889	0.35

Cross-References

Database	Links
UNIPROT	Q14677 B7Z6F8 D3DQJ6 Q8NAF1 Q96E05
PDB	1XGW 2QY7 2V8S
Pfam	PF01417
PROSITE	PS50942
OMIM	607265
DisGeNET	9685

Clathrin interactor 1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 1XGW)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (126 interactors)

Cross-References

Database

Links

Description

Description