Protein FAM209A - Homo sapiens

Protein FAM209A (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein FAM209A
Accession Code	Q5JX71
Gene	FAM209A
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 171)
MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVQYGEHFRIRQNLPEHTQGWLGSKWLWLLFVVVPFVILQCQRDSEKNKEQSPPGLRGGQLHSPLKKKRNASPNKDCAFNTLMELEVELMKFVSKV RNLKRAMATGSGSNLRLRKSEMPADPYHVTICEIWGEESSS

Subcellular Location

Description
Nucleus inner membrane {By SimilarityUniProtKB:A2APA5}; Single-pass type I membrane protein {Sequence Analysis}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Inner Membrane	SL-0179	The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Extracellular Exosome (GO:0070062) Nuclear Inner Membrane (GO:0005637) Nucleus (GO:0005634)

Biology & Function

Description
May play a role in sperm acrosome biogenesis. {By SimilarityUniProtKB:A2APA5}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Spermatogenesis (GO:0007283)
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q53HI1	Protein unc-50 homolog	EBI-24651712	0.56
Q5BJF2	Sigma intracellular receptor 2	EBI-24745243	0.56
Q9BXJ8	Ion channel TACAN	EBI-24660892	0.56
Q9NV29	Transmembrane protein 100	EBI-24699387	0.56
Q8IY26	Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6	EBI-24705960	0.56
Q8IXM6	Nurim	EBI-24729136	0.56
Q9H2S6	Tenomodulin	EBI-25282993	0.56
Q9BTV4	Transmembrane protein 43	EBI-24641558	0.56
Q9BUP3	Oxidoreductase HTATIP2	EBI-24643959	0.56
Q12982	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2	EBI-25279273	0.56
Q15125	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase	EBI-24758742	0.56
P50402	Emerin	EBI-24763501	0.56
Interactions with other proteins (215 interactors)

Partner (UniProt)		IntAct	Confidence score
P30519	Heme oxygenase 2 (HO-2) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 2 soluble form]	EBI-24659762	0.56
Q92482	Aquaporin-3 (AQP-3) (Aquaglyceroporin-3)	EBI-24661914	0.56
P55061	Bax inhibitor 1 (BI-1) (Testis-enhanced gene transcript protein) (Transmembrane BAX inhibitor motif-containing protein 6)	EBI-24663858	0.56
Q6UXB4	C-type lectin domain family 4 member G (Liver and lymph node sinusoidal endothelial cell C-type lectin) (LSECtin)	EBI-24665193	0.56
Q96F05	Uncharacterized protein C11orf24 (Protein DM4E3)	EBI-24665171	0.56
P24593	Insulin-like growth factor-binding protein 5 (IBP-5) (IGF-binding protein 5) (IGFBP-5)	EBI-24667567	0.56
Q8NBD8	Transmembrane protein 229B	EBI-24669580	0.56
Q7Z2K6	Endoplasmic reticulum metallopeptidase 1 (EC 3.4.-.-) (Felix-ina)	EBI-24669534	0.56
B2RUZ4	Small integral membrane protein 1 (Vel blood group antigen)	EBI-24670029	0.56
Q14508	WAP four-disulfide core domain protein 2 (Epididymal secretory protein E4) (Major epididymis-specific protein E4) (Putative protease inhibitor WAP5)	EBI-24673017	0.56
Q7Z769	Solute carrier family 35 member E3 (Bladder cancer-overexpressed gene 1 protein)	EBI-24674473	0.56
O14931	Natural cytotoxicity triggering receptor 3 (Activating natural killer receptor p30) (Natural killer cell p30-related protein) (NK-p30) (NKp30) (CD antigen CD337)	EBI-24674574	0.56
Q9BQB6	Vitamin K epoxide reductase complex subunit 1 (EC 1.17.4.4) (Vitamin K1 2,3-epoxide reductase subunit 1)	EBI-24675452	0.56
Q8NHY0	Beta-1,4 N-acetylgalactosaminyltransferase 2 (EC 2.4.1.-) (Sd(a) beta-1,4-GalNAc transferase) (UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase)	EBI-24675781	0.56
P43628	Killer cell immunoglobulin-like receptor 2DL3 (CD158 antigen-like family member B2) (KIR-023GB) (Killer inhibitory receptor cl 2-3) (NKAT2a) (NKAT2b) (Natural killer-associated transcript 2) (NKAT-2) (p58 natural killer cell receptor clone CL-6) (p58 NK receptor CL-6) (p58.2 MHC class-I-specific NK receptor) (CD antigen CD158b2)	EBI-24677593	0.56
Q8WVV5	Butyrophilin subfamily 2 member A2	EBI-24677762	0.56
O60883	G-protein coupled receptor 37-like 1 (Endothelin B receptor-like protein 2) (ETBR-LP-2)	EBI-24678057	0.56
Q9GZX9	Twisted gastrulation protein homolog 1	EBI-24678373	0.56
P01350	Gastrin [Cleaved into: Gastrin-71 (Gastrin component I); Gastrin-52 (G52); Big gastrin (Gastrin component II) (Gastrin-34) (G34); Gastrin (Gastrin component III) (Gastrin-17) (G17); Gastrin-14 (G14); Gastrin-6 (G6)]	EBI-24680641	0.56
Q96FZ5	CKLF-like MARVEL transmembrane domain-containing protein 7 (Chemokine-like factor superfamily member 7)	EBI-24681115	0.56
Q8WWP7	GTPase IMAP family member 1 (Immunity-associated protein 1) (hIMAP1)	EBI-24683139	0.56
O75063	Glycosaminoglycan xylosylkinase (EC 2.7.1.-) (Xylose kinase)	EBI-24683555	0.56
Q5VZY2	Phospholipid phosphatase 4 (EC 3.1.3.4) (EC 3.1.3.81) (Phosphatidic acid phosphatase type 2 domain-containing protein 1A)	EBI-24686702	0.56
Q96LB9	Peptidoglycan recognition protein 3 (Peptidoglycan recognition protein I-alpha) (PGLYRPIalpha) (PGRP-I-alpha) (Peptidoglycan recognition protein intermediate alpha)	EBI-24687412	0.56
Q92520	Protein FAM3C (Interleukin-like EMT inducer)	EBI-24688381	0.56
Q96GQ5	RUS family member 1	EBI-24692371	0.56
P23560	Brain-derived neurotrophic factor (BDNF) (Abrineurin) [Cleaved into: BDNF precursor form (ProBDNF)]	EBI-23726439	0.56
Q9UPQ8	Dolichol kinase (EC 2.7.1.108) (Transmembrane protein 15)	EBI-24693724	0.56
Q8WVX3	Uncharacterized protein C4orf3 (Hepatitis C virus F protein-transactivated protein 1) (HCV F-transactivated protein 1)	EBI-24694786	0.56
Q9Y5U4	Insulin-induced gene 2 protein (INSIG-2)	EBI-24696764	0.56
Q9HAB3	Solute carrier family 52, riboflavin transporter, member 2 (Porcine endogenous retrovirus A receptor 1) (PERV-A receptor 1) (Protein GPR172A) (Riboflavin transporter 3) (hRFT3)	EBI-24696666	0.56
P57739	Claudin-2 (SP82)	EBI-24697673	0.56
I3L0A0	HCG2044781 (PEDS1-UBE2V1 readthrough)	EBI-24698635	0.56
O14653	Golgi SNAP receptor complex member 2 (27 kDa Golgi SNARE protein) (Membrin)	EBI-24698512	0.56
Q969Y0	NXPE family member 3 (Protein FAM55C)	EBI-24699463	0.56
P02724	Glycophorin-A (MN sialoglycoprotein) (PAS-2) (Sialoglycoprotein alpha) (CD antigen CD235a)	EBI-24701121	0.56
Q9NUH8	Transmembrane protein 14B	EBI-24703342	0.56
Q9NPR9	Protein GPR108 (Lung seven transmembrane receptor 2)	EBI-24703316	0.56
P01375	Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form]	EBI-24703711	0.56
P54315	Inactive pancreatic lipase-related protein 1 (PL-RP1)	EBI-24703665	0.56
Q8IY49	Monocyte to macrophage differentiation factor 2 (Progestin and adipoQ receptor family member 10) (Progestin and adipoQ receptor family member X)	EBI-24703604	0.56
Q8TBB6	Probable cationic amino acid transporter (Solute carrier family 7 member 14)	EBI-24704053	0.56
P30536	Translocator protein (Mitochondrial benzodiazepine receptor) (PKBS) (Peripheral-type benzodiazepine receptor) (PBR)	EBI-24704355	0.56
Q9BQJ4	Transmembrane protein 47 (Brain cell membrane protein 1) (Transmembrane 4 superfamily member 10)	EBI-24706026	0.56
Q9Y6D0	Selenoprotein K (SelK)	EBI-24706768	0.56
Q8N2M4	Lysoplasmalogenase-like protein TMEM86A (Transmembrane protein 86A)	EBI-24707299	0.56
Q5BJH2	Transmembrane protein 128	EBI-24708034	0.56
Q8NHS1	Claudin domain-containing protein 2	EBI-24708497	0.56
Q1RMY5	SEMA6C protein	EBI-24709934	0.56
Q9Y6X1	Stress-associated endoplasmic reticulum protein 1 (Ribosome-attached membrane protein 4)	EBI-24711058	0.56
A5D903	PRB1 protein	EBI-24711648	0.56
Q71RG4	Transmembrane and ubiquitin-like domain-containing protein 2	EBI-24711927	0.56
P60033	CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)	EBI-24716011	0.56
O14735	CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC 2.7.8.11) (Phosphatidylinositol synthase) (PI synthase) (PtdIns synthase)	EBI-24717599	0.56
P02808	Statherin	EBI-24718795	0.56
Q8TBE7	Solute carrier family 35 member G2 (Transmembrane protein 22)	EBI-24719810	0.56
P37268	Squalene synthase (SQS) (SS) (EC 2.5.1.21) (FPP:FPP farnesyltransferase) (Farnesyl-diphosphate farnesyltransferase) (Farnesyl-diphosphate farnesyltransferase 1)	EBI-24720377	0.56
Q8NHW4	C-C motif chemokine 4-like (Lymphocyte activation gene 1 protein) (LAG-1) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Monocyte adherence-induced protein 5-alpha) (Small-inducible cytokine A4-like)	EBI-24720728	0.56
P41732	Tetraspanin-7 (Tspan-7) (Cell surface glycoprotein A15) (Membrane component chromosome X surface marker 1) (T-cell acute lymphoblastic leukemia-associated antigen 1) (TALLA-1) (Transmembrane 4 superfamily member 2) (CD antigen CD231)	EBI-24721505	0.56
Q969S6	Transmembrane protein 203	EBI-24723426	0.56
Q8WVQ1	Soluble calcium-activated nucleotidase 1 (SCAN-1) (EC 3.6.1.6) (Apyrase homolog) (Putative MAPK-activating protein PM09) (Putative NF-kappa-B-activating protein 107)	EBI-24724764	0.56
Q9C0I4	Thrombospondin type-1 domain-containing protein 7B	EBI-24726005	0.56
Q04941	Proteolipid protein 2 (Differentiation-dependent protein A4) (Intestinal membrane A4 protein)	EBI-24726747	0.56
P29033	Gap junction beta-2 protein (Connexin-26) (Cx26)	EBI-24727519	0.56
O75396	Vesicle-trafficking protein SEC22b (ER-Golgi SNARE of 24 kDa) (ERS-24) (ERS24) (SEC22 vesicle-trafficking protein homolog B) (SEC22 vesicle-trafficking protein-like 1)	EBI-24727475	0.56
Q96EC8	Protein YIPF6 (YIP1 family member 6)	EBI-24727308	0.56
Q9NZ01	Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER)	EBI-24728923	0.56
P11836	B-lymphocyte antigen CD20 (B-lymphocyte surface antigen B1) (Bp35) (Leukocyte surface antigen Leu-16) (Membrane-spanning 4-domains subfamily A member 1) (CD antigen CD20)	EBI-24729270	0.56
Q96I45	Transmembrane protein 141	EBI-24729879	0.56
Q96IW7	Vesicle-trafficking protein SEC22a (SEC22 vesicle-trafficking protein homolog A) (SEC22 vesicle-trafficking protein-like 2)	EBI-24731532	0.56
Q5W0B7	Transmembrane protein 236	EBI-24732788	0.56
Q9NZG7	Ninjurin-2 (Nerve injury-induced protein 2)	EBI-24733776	0.56
Q8TBM7	Transmembrane protein 254	EBI-24734476	0.56
Q86WK9	Membrane progestin receptor alpha (mPR alpha) (Membrane progesterone P4 receptor alpha) (Membrane progesterone receptor alpha) (Progesterone and adipoQ receptor family member 7) (Progestin and adipoQ receptor family member 7) (Progestin and adipoQ receptor family member VII)	EBI-24735695	0.56
P29972	Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Urine water channel) (Water channel protein for red blood cells and kidney proximal tubule)	EBI-24741655	0.56
P19397	Leukocyte surface antigen CD53 (Cell surface glycoprotein CD53) (Tetraspanin-25) (Tspan-25) (CD antigen CD53)	EBI-24741916	0.56
O60636	Tetraspanin-2 (Tspan-2) (Tetraspan NET-3)	EBI-24741870	0.56
Q9UHJ9	Post-GPI attachment to proteins factor 2 (FGF receptor-activating protein 1)	EBI-24743958	0.56
Q9H2L4	Transmembrane protein 60	EBI-24744254	0.56
Q15848	Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)	EBI-24744581	0.56
A0A0C4DFN3	Monoglyceride lipase	EBI-24748093	0.56
Q8TAF8	LHFPL tetraspan subfamily member 5 protein (Lipoma HMGIC fusion partner-like 5 protein) (Tetraspan membrane protein of hair cell stereocilia)	EBI-24748474	0.56
Q9UHX3	Adhesion G protein-coupled receptor E2 (EGF-like module receptor 2) (EGF-like module-containing mucin-like hormone receptor-like 2) (CD antigen CD312)	EBI-24750533	0.56
Q69YG0	Transmembrane protein 42	EBI-24750810	0.56
Q9NS64	Protein reprimo	EBI-24755295	0.56
Q6PI78	Transmembrane protein 65	EBI-24755815	0.56
Q9NS71	Gastrokine-1 (18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)	EBI-24755725	0.56
Q7Z7B8	Beta-defensin 128 (Beta-defensin 28) (DEFB-28) (Defensin, beta 128)	EBI-24763350	0.56
Q8N912	Nutritionally-regulated adipose and cardiac enriched protein homolog	EBI-24765153	0.56
O95183	Vesicle-associated membrane protein 5 (VAMP-5) (Myobrevin)	EBI-24766009	0.56
Q96S97	Myeloid-associated differentiation marker (Protein SB135)	EBI-24767098	0.56
Q4VAQ0	COL8A2 protein	EBI-24768660	0.56
Q13635	Protein patched homolog 1 (PTC) (PTC1)	EBI-24769357	0.56
P29034	Protein S100-A2 (CAN19) (Protein S-100L) (S100 calcium-binding protein A2)	EBI-24770320	0.56
Q5QGT7	Receptor-transporting protein 2 (3CxxC-type zinc finger protein 2)	EBI-24771029	0.56
Q9HCP6	Protein-cysteine N-palmitoyltransferase HHAT-like protein (Glycerol uptake/transporter homolog) (Hedgehog acyltransferase-like protein)	EBI-24771241	0.56
O14493	Claudin-4 (Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)	EBI-24771780	0.56
P41181	Aquaporin-2 (AQP-2) (ADH water channel) (Aquaporin-CD) (AQP-CD) (Collecting duct water channel protein) (WCH-CD) (Water channel protein for renal collecting duct)	EBI-24771883	0.56
Q9H3K2	Growth hormone-inducible transmembrane protein (Dermal papilla-derived protein 2) (Mitochondrial morphology and cristae structure 1) (MICS1) (Transmembrane BAX inhibitor motif-containing protein 5)	EBI-24773001	0.56
P02656	Apolipoprotein C-III (Apo-CIII) (ApoC-III) (Apolipoprotein C3)	EBI-24778709	0.56
Q9GZY8	Mitochondrial fission factor	EBI-24778858	0.56
Q9BVK2	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase (EC 2.4.1.265) (Asparagine-linked glycosylation protein 8 homolog) (Dol-P-Glc:Glc(1)Man(9)GlcNAc(2)-PP-dolichyl alpha-1,3-glucosyltransferase) (Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase)	EBI-24779310	0.56
Q8IWU4	Zinc transporter 8 (ZnT-8) (Solute carrier family 30 member 8)	EBI-24780535	0.56
Q92903	Phosphatidate cytidylyltransferase 1 (EC 2.7.7.41) (CDP-DAG synthase 1) (CDP-DG synthase 1) (CDP-diacylglycerol synthase 1) (CDS 1) (CDP-diglyceride pyrophosphorylase 1) (CDP-diglyceride synthase 1) (CTP:phosphatidate cytidylyltransferase 1)	EBI-24780869	0.56
Q7L5A8	Fatty acid 2-hydroxylase (EC 1.14.18.-) (Fatty acid alpha-hydroxylase) (Fatty acid hydroxylase domain-containing protein 1)	EBI-24781569	0.56
O75379	Vesicle-associated membrane protein 4 (VAMP-4)	EBI-24782054	0.56
Q86W74	Ankyrin repeat domain-containing protein 46 (Ankyrin repeat small protein) (ANK-S)	EBI-24782320	0.56
P05090	Apolipoprotein D (Apo-D) (ApoD)	EBI-24782399	0.56
O14569	Transmembrane reductase CYB561D2 (EC 7.2.1.3) (Cytochrome b561 domain-containing protein 2) (Putative tumor suppressor protein 101F6)	EBI-24783279	0.56
P26678	Cardiac phospholamban (PLB)	EBI-24784407	0.56
P02786	Transferrin receptor protein 1 (TR) (TfR) (TfR1) (Trfr) (T9) (p90) (CD antigen CD71) [Cleaved into: Transferrin receptor protein 1, serum form (sTfR)]	EBI-24784925	0.56
A6NDP7	Myeloid-associated differentiation marker-like protein 2	EBI-24785107	0.56
O95674	Phosphatidate cytidylyltransferase 2 (EC 2.7.7.41) (CDP-DAG synthase 2) (CDP-DG synthase 2) (CDP-diacylglycerol synthase 2) (CDS 2) (CDP-diglyceride pyrophosphorylase 2) (CDP-diglyceride synthase 2) (CTP:phosphatidate cytidylyltransferase 2)	EBI-24793784	0.56
Q7Z4F1	Low-density lipoprotein receptor-related protein 10 (LRP-10)	EBI-24793953	0.56
Q15546	Monocyte to macrophage differentiation factor (Progestin and adipoQ receptor family member 11) (Progestin and adipoQ receptor family member XI)	EBI-24794093	0.56
Q9P0N8	E3 ubiquitin-protein ligase MARCHF2 (EC 2.3.2.27) (Membrane-associated RING finger protein 2) (Membrane-associated RING-CH protein II) (MARCH-II) (RING finger protein 172) (RING-type E3 ubiquitin transferase MARCHF2)	EBI-24794270	0.56
Q8N609	Translocating chain-associated membrane protein 1-like 1	EBI-24795904	0.56
O95393	Bone morphogenetic protein 10 (BMP-10)	EBI-24798213	0.56
P13987	CD59 glycoprotein (1F5 antigen) (20 kDa homologous restriction factor) (HRF-20) (HRF20) (MAC-inhibitory protein) (MAC-IP) (MEM43 antigen) (Membrane attack complex inhibition factor) (MACIF) (Membrane inhibitor of reactive lysis) (MIRL) (Protectin) (CD antigen CD59)	EBI-25276491	0.56
P40313	Chymotrypsin-like protease CTRL-1 (EC 3.4.21.-)	EBI-25276423	0.56
Q59EV6	Carboxypeptidase (EC 3.4.16.-)	EBI-25276813	0.56
Q8N6F1	Claudin-19	EBI-25277574	0.56
Q8N661	Lysoplasmalogenase (EC 3.3.2.2) (Transmembrane protein 86B)	EBI-25278338	0.56
Q9HDC9	Adipocyte plasma membrane-associated protein (Protein BSCv)	EBI-25279172	0.56
P21964	Catechol O-methyltransferase (EC 2.1.1.6)	EBI-25279786	0.56
P29400	Collagen alpha-5(IV) chain	EBI-25280159	0.56
P56557	Transmembrane protein 50B (HCV p7-trans-regulated protein 3)	EBI-25280653	0.56
Q02094	Ammonium transporter Rh type A (Erythrocyte membrane glycoprotein Rh50) (Erythrocyte plasma membrane 50 kDa glycoprotein) (Rh50A) (Rhesus blood group family type A glycoprotein) (Rh family type A glycoprotein) (Rh type A glycoprotein) (Rhesus blood group-associated ammonia channel) (Rhesus blood group-associated glycoprotein) (CD antigen CD241)	EBI-25281444	0.56
Q9BQS2	Synaptotagmin-15 (Chr10Syt) (Synaptotagmin XV) (SytXV)	EBI-25281434	0.56
O95968	Secretoglobin family 1D member 1 (Lipophilin-A)	EBI-25283181	0.56
Q9NRS4	Transmembrane protease serine 4 (EC 3.4.21.-) (Channel-activating protease 2) (CAPH2) (Membrane-type serine protease 2) (MT-SP2) [Cleaved into: Transmembrane protease serine 4 catalytic chain]	EBI-25283685	0.56
Q8TDV0	G-protein coupled receptor 151 (G-protein coupled receptor PGR7) (GPCR-2037) (Galanin receptor 4) (Galanin-receptor-like protein) (GalRL)	EBI-25284292	0.56
Q9Y5Z9	UbiA prenyltransferase domain-containing protein 1 (EC 2.5.1.-) (Transitional epithelial response protein 1)	EBI-25285255	0.56
Q4LDR2	Cortexin-3 (Kidney and brain-expressed protein)	EBI-25285389	0.56
Q9Y385	Ubiquitin-conjugating enzyme E2 J1 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme J1) (Non-canonical ubiquitin-conjugating enzyme 1) (NCUBE-1) (Yeast ubiquitin-conjugating enzyme UBC6 homolog E) (HsUBC6e)	EBI-25285367	0.56
Q01453	Peripheral myelin protein 22 (PMP-22) (Growth arrest-specific protein 3) (GAS-3)	EBI-25286025	0.56
Q9Y3D6	Mitochondrial fission 1 protein (FIS1 homolog) (hFis1) (Tetratricopeptide repeat protein 11) (TPR repeat protein 11)	EBI-25287586	0.56
P09601	Heme oxygenase 1 (HO-1) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 1 soluble form]	EBI-25287799	0.56
Q13190	Syntaxin-5	EBI-25288503	0.56
Q86UF1	Tetraspanin-33 (Tspan-33) (Penumbra) (hPen) (Proerythroblast new membrane)	EBI-24641235	0.56
Q9UKR5	Ergosterol biosynthetic protein 28 homolog	EBI-24641314	0.56
Q9BTX3	Transmembrane protein 208	EBI-24641793	0.56
Q5J8X5	Membrane-spanning 4-domains subfamily A member 13 (Testis-expressed transmembrane protein 4)	EBI-24642453	0.56
Q9NRQ5	Single-pass membrane and coiled-coil domain-containing protein 4 (Protein FN5)	EBI-24642874	0.56
Q96LL9	DnaJ homolog subfamily C member 30, mitochondrial (Williams-Beuren syndrome chromosomal region 18 protein)	EBI-24643260	0.56
O75355	Ectonucleoside triphosphate diphosphohydrolase 3 (NTPDase 3) (EC 3.6.1.5) (CD39 antigen-like 3) (Ecto-ATP diphosphohydrolase 3) (Ecto-ATPDase 3) (Ecto-ATPase 3) (Ecto-apyrase 3) (HB6)	EBI-24643214	0.56
Q5NDL2	EGF domain-specific O-linked N-acetylglucosamine transferase (EC 2.4.1.255) (Extracellular O-linked N-acetylglucosamine transferase)	EBI-24645284	0.56
Q96G79	Probable UDP-sugar transporter protein SLC35A4 (Solute carrier family 35 member A4)	EBI-24646026	0.56
Q9BT09	Protein canopy homolog 3 (CTG repeat protein 4a) (Expanded repeat-domain protein CAG/CTG 5) (Protein associated with TLR4) (Trinucleotide repeat-containing gene 5 protein)	EBI-24647320	0.56
Q5J5C9	Beta-defensin 121 (Beta-defensin 21) (DEFB-21) (Defensin, beta 121)	EBI-24647994	0.56
Q9HD20	Endoplasmic reticulum transmembrane helix translocase (EC 7.4.2.-) (Endoplasmic reticulum P5A-ATPase)	EBI-24648696	0.56
Q8N138	ORM1-like protein 3	EBI-24649134	0.56
O43681	ATPase GET3 (EC 3.6.-.-) (Arsenical pump-driving ATPase) (Arsenite-stimulated ATPase) (Guided entry of tail-anchored proteins factor 3, ATPase) (Transmembrane domain recognition complex 40 kDa ATPase subunit) (hARSA-I) (hASNA-I)	EBI-24650187	0.56
Q9H0R3	Transmembrane protein 222	EBI-24650534	0.56
Q9H2C2	Protein ARV1 (hARV1)	EBI-24650290	0.56
P17152	Transmembrane protein 11, mitochondrial (Protein PM1) (Protein PMI)	EBI-24650279	0.56
Q13323	Bcl-2-interacting killer (Apoptosis inducer NBK) (BIP1) (BP4)	EBI-24651167	0.56
Q15836	Vesicle-associated membrane protein 3 (VAMP-3) (Cellubrevin) (CEB) (Synaptobrevin-3)	EBI-24651889	0.56
P60059	Protein transport protein Sec61 subunit gamma	EBI-24652003	0.56
Q12983	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3	EBI-24652350	0.56
A0PK05	Transmembrane protein 72 (Kidney-specific secretory protein of 37 kDa)	EBI-24652273	0.56
Q9BZW4	Transmembrane 6 superfamily member 2	EBI-24653078	0.56
P30301	Lens fiber major intrinsic protein (Aquaporin-0) (MIP26) (MP26)	EBI-24653337	0.56
O14798	Tumor necrosis factor receptor superfamily member 10C (Antagonist decoy receptor for TRAIL/Apo-2L) (Decoy TRAIL receptor without death domain) (Decoy receptor 1) (DcR1) (Lymphocyte inhibitor of TRAIL) (TNF-related apoptosis-inducing ligand receptor 3) (TRAIL receptor 3) (TRAIL-R3) (TRAIL receptor without an intracellular domain) (CD antigen CD263)	EBI-24653654	0.56
P07306	Asialoglycoprotein receptor 1 (ASGP-R 1) (ASGPR 1) (C-type lectin domain family 4 member H1) (Hepatic lectin H1) (HL-1)	EBI-24655518	0.56
Q6UX40	Transmembrane protein 107	EBI-24656181	0.56
Q6RW13	Type-1 angiotensin II receptor-associated protein (AT1 receptor-associated protein)	EBI-24657303	0.56
Q5BVD1	TPA-induced transmembrane protein	EBI-24659602	0.56
Q14162	Scavenger receptor class F member 1 (Acetyl LDL receptor) (Scavenger receptor expressed by endothelial cells 1) (SREC-I)	EBI-24659536	0.56
Q14802	FXYD domain-containing ion transport regulator 3 (Chloride conductance inducer protein Mat-8) (Mammary tumor 8 kDa protein) (Phospholemman-like) (Sodium/potassium-transporting ATPase subunit FXYD3)	EBI-24744695	0.56
O43169	Cytochrome b5 type B (Cytochrome b5 outer mitochondrial membrane isoform)	EBI-24745059	0.56
Q9Y6I9	Testis-expressed protein 264 (Putative secreted protein Zsig11)	EBI-24758880	0.56
Q9BSE2	Transmembrane protein 79 (Mattrin)	EBI-24759294	0.56
P06681	Complement C2 (EC 3.4.21.43) (C3/C5 convertase) [Cleaved into: Complement C2b fragment; Complement C2a fragment]	EBI-24759556	0.56
Q9NVC3	Putative sodium-coupled neutral amino acid transporter 7 (Solute carrier family 38 member 7)	EBI-24759878	0.56
P43005	Excitatory amino acid transporter 3 (Excitatory amino-acid carrier 1) (Neuronal and epithelial glutamate transporter) (Sodium-dependent glutamate/aspartate transporter 3) (Solute carrier family 1 member 1)	EBI-24761066	0.56
Q9BQE5	Apolipoprotein L2 (Apolipoprotein L-II) (ApoL-II)	EBI-24773951	0.56
A2RU14	Transmembrane protein 218	EBI-24774300	0.56
Q8WWT9	Na(+)/dicarboxylate cotransporter 3 (NaDC-3) (hNaDC3) (Na(+)-coupled carboxylate transporter 3) (NaC3) (Sodium-dependent high-affinity dicarboxylate transporter 2) (Solute carrier family 13 member 3) (SLC13A3)	EBI-24774991	0.56
Q9NWW5	Ceroid-lipofuscinosis neuronal protein 6 (Protein CLN6)	EBI-24775375	0.56
O76024	Wolframin	EBI-24776394	0.56
Q9UHE5	N-acetyltransferase 8 (EC 2.3.1.-) (Acetyltransferase 2) (ATase2) (Camello-like protein 1) (Cysteinyl-conjugate N-acetyltransferase) (CCNAT) (EC 2.3.1.80)	EBI-24776145	0.56
Q9BQA9	Cytochrome b-245 chaperone 1 (Essential for reactive oxygen species protein) (Eros)	EBI-24776598	0.56
Q6UX06	Olfactomedin-4 (OLM4) (Antiapoptotic protein GW112) (G-CSF-stimulated clone 1 protein) (hGC-1) (hOLfD)	EBI-24777357	0.56
Q9Y228	TRAF3-interacting JNK-activating modulator (TRAF3-interacting protein 3)	EBI-24787867	0.56
Q9BV81	ER membrane protein complex subunit 6 (Transmembrane protein 93)	EBI-24788001	0.56
Q9NRC9	Otoraplin (Fibrocyte-derived protein) (Melanoma inhibitory activity-like protein)	EBI-24788293	0.56
Q13277	Syntaxin-3	EBI-24788844	0.56
O43759	Synaptogyrin-1	EBI-24789665	0.56
O95159	Zinc finger protein-like 1 (Zinc finger protein MCG4)	EBI-24790231	0.56
Q9BU79	Transmembrane protein 243 (MDR1- and mitochondrial taxol resistance-associated protein) (MM-TRAG)	EBI-24792203	0.56
Q9UBY5	Lysophosphatidic acid receptor 3 (LPA receptor 3) (LPA-3) (Lysophosphatidic acid receptor Edg-7)	EBI-24792539	0.56
O75711	Scrapie-responsive protein 1 (Scrapie-responsive gene 1 protein) (ScRG-1)	EBI-24800001	0.56
P60201	Myelin proteolipid protein (PLP) (Lipophilin)	EBI-24802443	0.56
Q969F0	Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)	EBI-24802386	0.56
P11686	Pulmonary surfactant-associated protein C (SP-C) (Pulmonary surfactant-associated proteolipid SPL(Val)) (SP5)	EBI-24803127	0.56
Q969S0	UDP-xylose and UDP-N-acetylglucosamine transporter (Solute carrier family 35 member B4) (YEA4 homolog)	EBI-24803316	0.56
O95406	Protein cornichon homolog 1 (CNIH-1) (Cornichon family AMPA receptor auxiliary protein 1) (Protein cornichon homolog) (T-cell growth-associated molecule 77) (TGAM77)	EBI-24804040	0.56
Q9P0S9	Transmembrane protein 14C	EBI-24804775	0.56
Q8N5M9	Protein jagunal homolog 1	EBI-24804922	0.56
O75841	Uroplakin-1b (UP1b) (Tetraspanin-20) (Tspan-20) (Uroplakin Ib) (UPIb)	EBI-24809719	0.56
Q96GC9	Vacuole membrane protein 1 (Transmembrane protein 49)	EBI-24810789	0.56
Q9NVV5	Androgen-induced gene 1 protein (AIG-1) (Fatty acid esters of hydroxy fatty acids hydrolase AIG1) (FAHFA hydrolase AIG1) (EC 3.1.-.-)	EBI-24810993	0.56
Q86XP6	Gastrokine-2 (Blottin) (Down-regulated in gastric cancer) (Trefoil factor interactions(z) 1)	EBI-25266404	0.56
Q6UX34	Protein SNORC (Secondary ossification center-associated regulator of chondrocyte maturation protein)	EBI-25267080	0.56
P21145	Myelin and lymphocyte protein (T-lymphocyte maturation-associated protein)	EBI-25267772	0.56
Q9H115	Beta-soluble NSF attachment protein (SNAP-beta) (N-ethylmaleimide-sensitive factor attachment protein beta)	EBI-25269370	0.56
P78382	CMP-sialic acid transporter (CMP-SA-Tr) (CMP-Sia-Tr) (Solute carrier family 35 member A1)	EBI-25269850	0.56
O15155	BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18)	EBI-25270807	0.56
Q9NV12	Transmembrane protein 140	EBI-25270546	0.56
P07204	Thrombomodulin (TM) (Fetomodulin) (CD antigen CD141)	EBI-25271156	0.56
Q9UNK0	Syntaxin-8	EBI-25271982	0.56
Q6Y1H2	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 2) (HACD2) (Protein-tyrosine phosphatase-like member B)	EBI-25273339	0.56
P61266	Syntaxin-1B (Syntaxin-1B1) (Syntaxin-1B2)	EBI-25273755	0.56
Q8TF42	Ubiquitin-associated and SH3 domain-containing protein B (EC 3.1.3.48) (Cbl-interacting protein p70) (Suppressor of T-cell receptor signaling 1) (STS-1) (T-cell ubiquitin ligand 2) (TULA-2) (Tyrosine-protein phosphatase STS1/TULA2)	EBI-21896717	0.40

Cross-References

Database	Links
UNIPROT	Q5JX71 Q05C43
Pfam	PF15206

Protein FAM209A (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Interactions with other proteins (215 interactors)

Cross-References

Database

Links

Description

Description