Protein Information |
|
|---|---|
| Protein Name | Emerin |
| Accession Code | P50402 |
| Gene | EMD |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 254) | |
|
MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKE DALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSA YQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF FIYHFMQAEEGNPF |
|
Structure Viewer (PDB: 2ODG) |
|---|
Description |
||
|---|---|---|
| Nucleus inner membrane {Experimental EvidencePubMed:19167377}; Single-pass membrane protein; Nucleoplasmic side {Experimental EvidencePubMed:19167377}. Nucleus outer membrane. Note=Colocalized with BANF1 at the central region of the assembling nuclear rim, near spindle-attachment sites. The accumulation of different intermediates of prelamin-A/C (non-farnesylated or carboxymethylated farnesylated prelamin-A/C) in fibroblasts modify its localization in the nucleus. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Inner Membrane | SL-0179 | The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina. |
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. |
| Nuclear Outer Membrane | SL-0183 | The outer membrane of the nucleus is the membrane facing the cytoplasm. In mammals, the outer nuclear membrane is continuous in many places with the rough endoplasmic reticulum and is dotted with ribosomes. | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Membrane (GO:0016020) Microtubule (GO:0005874) Nuclear Envelope (GO:0005635) Nuclear Inner Membrane (GO:0005637) Nuclear Membrane (GO:0031965) Nuclear Outer Membrane (GO:0005640) Nucleoplasm (GO:0005654) Spindle (GO:0005819) |
|
Description |
|
|---|---|
| Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta- catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta-catenin through a CRM1- dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. Required for proper localization of non- farnesylated prelamin-A/C. Together with NEMP1, contributes to nuclear envelope stiffness in germ cells (PubMed:32923640). EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. {Experimental EvidencePubMed:15328537, Experimental EvidencePubMed:16680152, Experimental EvidencePubMed:16858403, Experimental EvidencePubMed:17785515, Experimental EvidencePubMed:19323649, Experimental EvidencePubMed:32923640}. | Assigned Ontology terms |
| Biological Process | Cellular Response To Growth Factor Stimulus (GO:0071363) Muscle Contraction (GO:0006936) Muscle Organ Development (GO:0007517) Negative Regulation Of Canonical Wnt Signaling Pathway (GO:0090090) Negative Regulation Of Fibroblast Proliferation (GO:0048147) Nuclear Membrane Organization (GO:0071763) Positive Regulation Of Protein Export From Nucleus (GO:0046827) Regulation Of Canonical Wnt Signaling Pathway (GO:0060828) Skeletal Muscle Cell Differentiation (GO:0035914) |
| Molecular Function | Actin Binding (GO:0003779) Beta-Tubulin Binding (GO:0048487) Cadherin Binding (GO:0045296) |
Description |
|
|---|---|
| Emery-Dreifuss muscular dystrophy 1, X-linked (EDMD1) [MIM:310300]: A form of Emery-Dreifuss muscular dystrophy, a degenerative myopathy characterized by weakness and atrophy of muscle without involvement of the nervous system, early contractures of the elbows, Achilles tendons and spine, and cardiomyopathy associated with cardiac conduction defects. {Experimental EvidencePubMed:10323252, Experimental EvidencePubMed:11587540, Experimental EvidencePubMed:15009215, Experimental EvidencePubMed:15328537}. Note=The disease is caused by variants affecting the gene represented in this entry. | Database Associations |
| OMIM | 300384 310300 |
| DisGeNET | 2010 |
Interactions with Nuclear Envelope proteins (23 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A1L3G9 | Nuclear envelope integral membrane protein 1b | EBI-12595918 | 0.40 |
| O94901 | SUN domain-containing protein 1 | EBI-22057164 | 0.46 |
| P01112 | GTPase HRas, N-terminally processed | EBI-27045317 | 0.27 |
| P02545 | Lamin-A/C | EBI-16795756 | 0.80 |
| P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-32718334 | 0.35 |
| P0DTC7 | ORF7a protein | EBI-25510184 | 0.35 |
| P13285 | Latent membrane protein 2 | EBI-11733017 | 0.35 |
| P35240 | Merlin | EBI-23824818 | 0.56 |
| Q9UH99 | SUN domain-containing protein 2 | EBI-6753091 | 0.64 |
| Q9D666 | SUN domain-containing protein 1 | EBI-6752609 | 0.52 |
| P50402 | Self | EBI-10484783 | 0.37 |
| P53671 | LIM domain kinase 2 | EBI-10103591 | 0.35 |
| Q8NF91 | Nesprin-1 | EBI-10759458 | 0.52 |
| Q8WXH0 | Nesprin-2 | EBI-10760372 | 0.58 |
| Q8N6L0 | Protein KASH5 | EBI-11774371 | 0.79 |
| Q5JX71 | Protein FAM209A | EBI-24763501 | 0.56 |
| Q5SNT2 | Transmembrane protein 201 | EBI-24476865 | 0.68 |
| Q9BTV4 | Transmembrane protein 43 | EBI-22085077 | 0.54 |
| Q6P5Z2 | Serine/threonine-protein kinase N3 | EBI-28941754 | 0.35 |
| O75531 | Barrier-to-autointegration factor, N-terminally processed | EBI-10759397 | 0.94 |
| Q7L5N1 | COP9 signalosome complex subunit 6 | EBI-731797 | 0.00 |
| P03246 | E1B protein, small T-antigen | EBI-11722343 | 0.35 |
| P00533 | Epidermal growth factor receptor | EBI-32717697 | 0.42 | Interactions with other proteins (245 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q9NYF8 | Bcl-2-associated transcription factor 1 (Btf) (BCLAF1 and THRAP3 family member 1) | EBI-489904 | 0.59 |
| Q7L190 | Developmental pluripotency-associated protein 4 | EBI-731800 | 0.00 |
| Q99962 | Endophilin-A1 (EEN-B1) (Endophilin-1) (SH3 domain protein 2A) (SH3 domain-containing GRB2-like protein 2) | EBI-710249 | 0.51 |
| Q99963 | Endophilin-A3 (EEN-B2) (Endophilin-3) (SH3 domain protein 2C) (SH3 domain-containing GRB2-like protein 3) | EBI-731806 | 0.00 |
| Q969F0 | Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2) | EBI-753397 | 0.85 |
| O43889 | Cyclic AMP-responsive element-binding protein 3 (CREB-3) (cAMP-responsive element-binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP-alpha) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 (N-terminal Luman) (Transcriptionally active form)] | EBI-12701204 | 0.56 |
| Q8N7W2 | BEN domain-containing protein 7 | EBI-10211848 | 0.81 |
| P35222 | Catenin beta-1 (Beta-catenin) | EBI-8577506 | 0.59 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-1171716 | 0.53 |
| Q9UKV8 | Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer) | EBI-7642406 | 0.35 |
| P04296 | Major DNA-binding protein | EBI-9631489 | 0.35 |
| Q9HCK5 | Protein argonaute-4 (Argonaute4) (hAgo4) (Argonaute RISC catalytic component 4) (Eukaryotic translation initiation factor 2C 4) (eIF-2C 4) (eIF2C 4) | EBI-2269711 | 0.35 |
| O70126 | Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine/threonine-protein kinase aurora-B) | EBI-2557780 | 0.40 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-2877710 | 0.35 |
| Q9BQS8 | FYVE and coiled-coil domain-containing protein 1 (Zinc finger FYVE domain-containing protein 7) | EBI-3242919 | 0.35 |
| Q15051 | IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ) | EBI-4286917 | 0.35 |
| P51858 | Hepatoma-derived growth factor (HDGF) (High mobility group protein 1-like 2) (HMG-1L2) | EBI-4409719 | 0.35 |
| Q16659 | Mitogen-activated protein kinase 6 (MAP kinase 6) (MAPK 6) (EC 2.7.11.24) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97-MAPK) | EBI-7207761 | 0.37 |
| P0DOE9 | Non-structural protein 1 (NS1) (Non-structural protein 1C) | EBI-6138583 | 0.35 |
| P19320 | Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) | EBI-6191076 | 0.53 |
| Q77M19 | V protein | EBI-6270503 | 0.35 |
| Q13617 | Cullin-2 (CUL-2) | EBI-21327106 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| P22893 | mRNA decay activator protein ZFP36 (Growth factor-inducible nuclear protein NUP475) (TPA-induced sequence 11) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36) | EBI-6506418 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-6515609 | 0.53 |
| P57078 | Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase) | EBI-12503575 | 0.35 |
| Q8IWZ5 | Tripartite motif-containing protein 42 | EBI-10211808 | 0.72 |
| Q53Z40 | HCG1 protein (Zinc finger protein 165) | EBI-10211828 | 0.56 |
| Q5JST6 | EF-hand domain-containing family member C2 | EBI-10211838 | 0.56 |
| Q8NEC5 | Cation channel sperm-associated protein 1 (CatSper1) (hCatSper) | EBI-10211860 | 0.81 |
| Q9P286 | Serine/threonine-protein kinase PAK 5 (EC 2.7.11.1) (p21-activated kinase 5) (PAK-5) (p21-activated kinase 7) (PAK-7) | EBI-10211880 | 0.56 |
| Q8NHQ1 | Centrosomal protein of 70 kDa (Cep70) (p10-binding protein) | EBI-10211870 | 0.72 |
| Q9P127 | Leucine zipper protein 4 (Cancer/testis antigen 28) (CT-28) (CT28) (Tumor antigen HOM-TES-85) | EBI-10211900 | 0.81 |
| Q9UNY5 | Zinc finger protein 232 (Zinc finger and SCAN domain-containing protein 11) | EBI-10211910 | 0.56 |
| Q9Y228 | TRAF3-interacting JNK-activating modulator (TRAF3-interacting protein 3) | EBI-10211920 | 0.81 |
| Q13895 | Bystin | EBI-10230959 | 0.72 |
| Q8N8X9 | Protein mab-21-like 3 | EBI-10268015 | 0.56 |
| Q8WTP8 | Apoptosis-enhancing nuclease (EC 3.1.-.-) (Interferon-stimulated 20 kDa exonuclease-like 1) | EBI-10275770 | 0.56 |
| Q9ULW3 | Activator of basal transcription 1 (hABT1) (Basal transcriptional activator) | EBI-10323933 | 0.72 |
| O14862 | Interferon-inducible protein AIM2 (Absent in melanoma 2) | EBI-9995694 | 0.35 |
| P10398 | Serine/threonine-protein kinase A-Raf (EC 2.7.11.1) (Proto-oncogene A-Raf) (Proto-oncogene A-Raf-1) (Proto-oncogene Pks) | EBI-10101587 | 0.35 |
| Q13418 | Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK) | EBI-10103376 | 0.35 |
| P51617 | Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1) | EBI-10103481 | 0.53 |
| O60674 | Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2) | EBI-10103554 | 0.35 |
| P04049 | RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1) | EBI-10104226 | 0.53 |
| Q9H0K1 | Serine/threonine-protein kinase SIK2 (EC 2.7.11.1) (Qin-induced kinase) (Salt-inducible kinase 2) (SIK-2) (Serine/threonine-protein kinase SNF1-like kinase 2) | EBI-10104403 | 0.35 |
| P03177 | Thymidine kinase (EC 2.7.1.21) | EBI-11721652 | 0.35 |
| P03179 | Major tegument protein (MTP) (Protein p140) | EBI-11721697 | 0.35 |
| P03182 | Apoptosis regulator BHRF1 (Early antigen protein R) (EA-R) (Nuclear antigen) | EBI-11721938 | 0.35 |
| P03225 | Protein BDLF2 | EBI-11722220 | 0.35 |
| P06460 | Probable protein E5A | EBI-11723082 | 0.35 |
| P06461 | Probable protein E5B | EBI-11723785 | 0.35 |
| P06792 | Probable protein E5 | EBI-11724527 | 0.35 |
| P06927 | Probable protein E5 | EBI-11724813 | 0.35 |
| P0C739 | Protein BNLF2a | EBI-11725101 | 0.35 |
| P0CK56 | Uncharacterized protein BDLF4 | EBI-11725466 | 0.35 |
| P0CK58 | Apoptosis regulator BALF1 | EBI-11732874 | 0.35 |
| P30119 | Uncharacterized protein BTRF1 | EBI-11733103 | 0.35 |
| P69901 | Probable protein E5B | EBI-11733364 | 0.35 |
| Q2MG95 | BVLF1 | EBI-11733653 | 0.35 |
| Q2MG96 | BGLF3.5 protein | EBI-11733890 | 0.35 |
| Q8AZK7 | Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5) | EBI-11734159 | 0.35 |
| Q8AZJ3 | Uncharacterized protein BNLF2b | EBI-11734105 | 0.35 |
| E9QKK1 | Centromere-associated protein E | EBI-10995761 | 0.35 |
| Q9Z1B5 | Mitotic spindle assembly checkpoint protein MAD2A (Mitotic arrest deficient 2-like protein 1) (MAD2-like protein 1) | EBI-10996176 | 0.35 |
| P36895 | Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292) | EBI-11008521 | 0.35 |
| P31150 | Rab GDP dissociation inhibitor alpha (Rab GDI alpha) (Guanosine diphosphate dissociation inhibitor 1) (GDI-1) (Oligophrenin-2) (Protein XAP-4) | EBI-11035437 | 0.35 |
| Q9Z2X1 | Heterogeneous nuclear ribonucleoprotein F (hnRNP F) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N-terminally processed] | EBI-11066678 | 0.35 |
| F8VQC7 | Kinectin | EBI-11104527 | 0.35 |
| Q6ZNC8 | Lysophospholipid acyltransferase 1 (LPLAT 1) (1-acylglycerophosphocholine O-acyltransferase) (EC 2.3.1.23) (1-acylglycerophosphoethanolamine O-acyltransferase) (EC 2.3.1.n7) (1-acylglycerophosphoserine O-acyltransferase MBOAT1) (EC 2.3.1.n6) (Lysophosphatidylserine acyltransferase) (LPSAT) (Lyso-PS acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 1) (O-acyltransferase domain-containing protein 1) | EBI-11121915 | 0.35 |
| Q5T3F8 | CSC1-like protein 2 (Transmembrane protein 63B) | EBI-11155257 | 0.35 |
| Q6NUS6 | Tectonic-3 | EBI-11368748 | 0.27 |
| Q86UK5 | Limbin (Ellis-van Creveld syndrome protein 2) (EVC2) | EBI-11372136 | 0.27 |
| Q86X19 | Transmembrane protein 17 | EBI-11372615 | 0.27 |
| Q96GX1 | Tectonic-2 | EBI-11375285 | 0.27 |
| Q9P0N5 | Transmembrane protein 216 | EBI-11378021 | 0.27 |
| Q96Q45 | Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein) | EBI-11396533 | 0.27 |
| P48039 | Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor) | EBI-11575834 | 0.37 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-11897791 | 0.53 |
| Q6FHY5 | MEOX2 protein | EBI-24279203 | 0.56 |
| Q9BYN7 | Zinc finger protein 341 | EBI-24339377 | 0.56 |
| Q04864 | Proto-oncogene c-Rel | EBI-24344788 | 0.56 |
| Q16623 | Syntaxin-1A (Neuron-specific antigen HPC-1) | EBI-24487831 | 0.56 |
| Q6P2D0 | Zinc finger protein 1 homolog (Zfp-1) (Zinc finger protein 475) | EBI-24525478 | 0.56 |
| P20138 | Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33) | EBI-24662714 | 0.56 |
| Q5JRM2 | Uncharacterized protein CXorf66 | EBI-23676624 | 0.56 |
| Q8N5K1 | CDGSH iron-sulfur domain-containing protein 2 (Endoplasmic reticulum intermembrane small protein) (MitoNEET-related 1 protein) (Miner1) (Nutrient-deprivation autophagy factor-1) (NAF-1) | EBI-23679672 | 0.56 |
| Q96HE8 | Transmembrane protein 80 | EBI-24667793 | 0.56 |
| Q6NX45 | Zinc finger protein 774 | EBI-24670601 | 0.56 |
| B7U540 | Inward rectifier potassium channel 18 (Inward rectifier K(+) channel Kir2.6) (Potassium channel, inwardly rectifying subfamily J member 18) | EBI-24672111 | 0.56 |
| A6NEL2 | Ankyrin repeat domain-containing protein SOWAHB (Ankyrin repeat domain-containing protein 56) (Protein sosondowah homolog B) | EBI-23696046 | 0.56 |
| Q15842 | ATP-sensitive inward rectifier potassium channel 8 (Inward rectifier K(+) channel Kir6.1) (Potassium channel, inwardly rectifying subfamily J member 8) (uKATP-1) | EBI-24689183 | 0.56 |
| Q9NQX5 | Neural proliferation differentiation and control protein 1 (NPDC-1) | EBI-24699630 | 0.56 |
| Q8N4V1 | ER membrane protein complex subunit 5 (Membrane magnesium transporter 1) (Transmembrane protein 32) | EBI-24709706 | 0.56 |
| Q7RTU1 | Transcription factor 23 (TCF-23) (Class A basic helix-loop-helix protein 24) (bHLHa24) | EBI-23756438 | 0.56 |
| O60930 | Ribonuclease H1 (RNase H1) (EC 3.1.26.4) (Ribonuclease H type II) | EBI-23758332 | 0.56 |
| Q0VD86 | Protein INCA1 (Inhibitor of CDK interacting with cyclin A1) | EBI-24717955 | 0.56 |
| Q7Z6M4 | Transcription termination factor 4, mitochondrial (Mitochondrial transcription termination factor 4) (mTERF domain-containing protein 2) [Cleaved into: mTERF domain-containing protein 2 processed] | EBI-23772605 | 0.56 |
| Q9Y320 | Thioredoxin-related transmembrane protein 2 (Cell proliferation-inducing gene 26 protein) (Thioredoxin domain-containing protein 14) | EBI-23795943 | 0.56 |
| P16157 | Ankyrin-1 (ANK-1) (Ankyrin-R) (Erythrocyte ankyrin) | EBI-24733419 | 0.56 |
| Q9HA82 | Ceramide synthase 4 (CerS4) (EC 2.3.1.-) (LAG1 longevity assurance homolog 4) (Sphingosine N-acyltransferase CERS4) (EC 2.3.1.24) | EBI-23800001 | 0.56 |
| P43628 | Killer cell immunoglobulin-like receptor 2DL3 (CD158 antigen-like family member B2) (KIR-023GB) (Killer inhibitory receptor cl 2-3) (NKAT2a) (NKAT2b) (Natural killer-associated transcript 2) (NKAT-2) (p58 natural killer cell receptor clone CL-6) (p58 NK receptor CL-6) (p58.2 MHC class-I-specific NK receptor) (CD antigen CD158b2) | EBI-24742152 | 0.56 |
| Q9BSJ6 | Protein PIMREG (CALM-interactor expressed in thymus and spleen) (PICALM-interacting mitotic regulator) (Regulator of chromosome segregation protein 1) | EBI-24763001 | 0.56 |
| Q6IBW4 | Condensin-2 complex subunit H2 (Chromosome-associated protein H2) (hCAP-H2) (Kleisin-beta) (Non-SMC condensin II complex subunit H2) | EBI-23853144 | 0.56 |
| Q86VY9 | Transmembrane protein 200A | EBI-24778276 | 0.56 |
| Q8TDT2 | Probable G-protein coupled receptor 152 (G-protein coupled receptor PGR5) | EBI-25275476 | 0.56 |
| Q5T7V8 | RAB6-interacting golgin (N-terminal kinase-like-binding protein 1) (NTKL-BP1) (NTKL-binding protein 1) (hNTKL-BP1) (SCY1-like 1-binding protein 1) (SCYL1-BP1) (SCYL1-binding protein 1) | EBI-23923221 | 0.56 |
| Q8IUY3 | GRAM domain-containing protein 2A | EBI-24390287 | 0.56 |
| P50221 | Homeobox protein MOX-1 (Mesenchyme homeobox 1) | EBI-24397223 | 0.56 |
| O75031 | Heat shock factor 2-binding protein | EBI-24417083 | 0.56 |
| Q9HAQ2 | Kinesin-like protein KIF9 | EBI-24439983 | 0.56 |
| Q8TD17 | Zinc finger protein 398 (Zinc finger DNA-binding protein p52/p71) | EBI-24447341 | 0.56 |
| Q96S94 | Cyclin-L2 (Paneth cell-enhanced expression protein) | EBI-24556880 | 0.56 |
| Q6P9A3 | Zinc finger protein 549 | EBI-24557406 | 0.56 |
| Q9NU63 | Zinc finger protein 57 homolog (Zfp-57) (Zinc finger protein 698) | EBI-24580547 | 0.56 |
| Q5T686 | Arginine vasopressin-induced protein 1 (AVP-induced protein 1) | EBI-24599743 | 0.56 |
| P21964 | Catechol O-methyltransferase (EC 2.1.1.6) | EBI-24641360 | 0.56 |
| Q86UD4 | Zinc finger protein 329 | EBI-24646904 | 0.56 |
| Q96PL5 | Erythroid membrane-associated protein (hERMAP) (Radin blood group antigen) (Scianna blood group antigen) | EBI-25169259 | 0.56 |
| Q4KMG9 | Transmembrane protein 52B | EBI-24747207 | 0.56 |
| Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 (Ankyrin repeat domain-containing protein 14) (SamCystin) (Sterile alpha motif domain-containing protein 6) (SAM domain-containing protein 6) | EBI-25195191 | 0.56 |
| Q9BRJ2 | 39S ribosomal protein L45, mitochondrial (L45mt) (MRP-L45) (Mitochondrial large ribosomal subunit protein mL45) | EBI-24789200 | 0.56 |
| Q14500 | ATP-sensitive inward rectifier potassium channel 12 (Inward rectifier K(+) channel Kir2.2) (IRK-2) (Inward rectifier K(+) channel Kir2.2v) (Potassium channel, inwardly rectifying subfamily J member 12) | EBI-24790299 | 0.56 |
| Q7Z7G2 | Complexin-4 (Complexin IV) (CPX IV) | EBI-25207978 | 0.56 |
| Q9H400 | Lck-interacting transmembrane adapter 1 (Lck-interacting membrane protein) (Lck-interacting molecule) | EBI-24799476 | 0.56 |
| Q8WWF3 | Serine-rich single-pass membrane protein 1 | EBI-24800633 | 0.56 |
| Q9UGI6 | Small conductance calcium-activated potassium channel protein 3 (SK3) (SKCa 3) (SKCa3) (KCa2.3) | EBI-24807534 | 0.56 |
| Q86T13 | C-type lectin domain family 14 member A (Epidermal growth factor receptor 5) (EGFR-5) | EBI-25224374 | 0.56 |
| Q8WUU8 | Transmembrane protein 174 | EBI-25273036 | 0.56 |
| P49910 | Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7) | EBI-12696914 | 0.56 |
| O95292 | Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) | EBI-12698321 | 0.56 |
| Q9NTW7 | Zinc finger protein 64 (Zfp-64) (Zinc finger protein 338) | EBI-12700590 | 0.56 |
| Q12846 | Syntaxin-4 (Renal carcinoma antigen NY-REN-31) | EBI-12702158 | 0.56 |
| P50222 | Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2) | EBI-12702328 | 0.56 |
| Q8N5R6 | Coiled-coil domain-containing protein 33 (Cancer/testis antigen 61) (CT61) | EBI-12702476 | 0.56 |
| O14829 | Serine/threonine-protein phosphatase with EF-hands 1 (PPEF-1) (EC 3.1.3.16) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine-protein phosphatase 7) (PP7) | EBI-14024386 | 0.35 |
| P56180 | Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5) | EBI-14025693 | 0.57 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
| Q05322 | Membrane-associated protein VP24 (Ebola VP24) (eVP24) | EBI-15481401 | 0.35 |
| P60709 | Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-15531451 | 0.52 |
| P68135 | Actin, alpha skeletal muscle (EC 3.6.4.-) (Alpha-actin-1) [Cleaved into: Actin, alpha skeletal muscle, intermediate form] | EBI-15531470 | 0.60 |
| Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-16686997 | 0.35 |
| O15155 | BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18) | EBI-16788067 | 0.27 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-16788621 | 0.27 |
| P68431 | Histone H3.1 (Histone H3/a) (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l) | EBI-16793336 | 0.27 |
| P11279 | Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) | EBI-16794808 | 0.27 |
| Q9HBL7 | Plasminogen receptor (KT) (Plg-R(KT)) | EBI-16797780 | 0.27 |
| P62491 | Ras-related protein Rab-11A (Rab-11) (EC 3.6.5.2) (YL8) | EBI-16797971 | 0.27 |
| P20339 | Ras-related protein Rab-5A (EC 3.6.5.2) | EBI-16798221 | 0.27 |
| P51151 | Ras-related protein Rab-9A | EBI-16798325 | 0.27 |
| P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-16798663 | 0.27 |
| O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.42 |
| Q9NS69 | Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog) | EBI-16802054 | 0.27 |
| Q7KZN9 | Cytochrome c oxidase assembly protein COX15 homolog | EBI-20304305 | 0.35 |
| P36957 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K) | EBI-20305285 | 0.35 |
| P08559 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) | EBI-20306509 | 0.35 |
| P35610 | Sterol O-acyltransferase 1 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 1) (ACAT-1) (Cholesterol acyltransferase 1) | EBI-20307233 | 0.35 |
| P21796 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) | EBI-20307902 | 0.35 |
| Q9HCE5 | N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14) | EBI-20595531 | 0.35 |
| P51957 | Serine/threonine-protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A-related kinase 4) (NimA-related protein kinase 4) (Serine/threonine-protein kinase 2) (Serine/threonine-protein kinase NRK2) | EBI-20721387 | 0.35 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q5T7N2 | LINE-1 type transposase domain-containing protein 1 (ES cell-associated protein 11) | EBI-20993270 | 0.35 |
| P14316 | Interferon regulatory factor 2 (IRF-2) | EBI-21260627 | 0.35 |
| Q15077 | P2Y purinoceptor 6 (P2Y6) | EBI-21262943 | 0.35 |
| F5H1C8 | Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a) | EBI-21264930 | 0.35 |
| Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | EBI-21265865 | 0.35 |
| Q9NQB0 | Transcription factor 7-like 2 (HMG box transcription factor 4) (T-cell-specific transcription factor 4) (T-cell factor 4) (TCF-4) (hTCF-4) | EBI-21265942 | 0.35 |
| Q9H1C4 | Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1) | EBI-21266770 | 0.35 |
| Q13163 | Dual specificity mitogen-activated protein kinase kinase 5 (MAP kinase kinase 5) (MAPKK 5) (EC 2.7.12.2) (MAPK/ERK kinase 5) (MEK 5) | EBI-25374437 | 0.35 |
| Q15311 | RalA-binding protein 1 (RalBP1) (76 kDa Ral-interacting protein) (Dinitrophenyl S-glutathione ATPase) (DNP-SG ATPase) (EC 7.6.2.2, EC 7.6.2.3) (Ral-interacting protein 1) | EBI-25375541 | 0.35 |
| Q92934 | Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) | EBI-25378368 | 0.35 |
| P19419 | ETS domain-containing protein Elk-1 | EBI-25378580 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| Q9H9V9 | 2-oxoglutarate and iron-dependent oxygenase JMJD4 (EC 1.14.11.-) (JmjC domain-containing protein 4) (Jumonji domain-containing protein 4) (Lysyl-hydroxylase JMJD4) | EBI-25479633 | 0.35 |
| Q8N5Y8 | Protein mono-ADP-ribosyltransferase PARP16 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 15) (Poly [ADP-ribose] polymerase 16) (PARP-16) | EBI-25482187 | 0.35 |
| P69479 | Phosphoprotein (Protein P) (Protein M1) | EBI-25568044 | 0.35 |
| P0DTC4 | Envelope small membrane protein (E) (sM protein) | EBI-25509966 | 0.35 |
| P0DTC8 | ORF8 protein (ORF8) (Non-structural protein 8) (ns8) | EBI-25510273 | 0.35 |
| P0DTD3 | Putative ORF9c protein (ORF9c) (Uncharacterized protein 14) (ORF14) | EBI-25510342 | 0.35 |
| Q96CS3 | FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8) | EBI-25770166 | 0.35 |
| Q8IWF2 | FAD-dependent oxidoreductase domain-containing protein 2 (Endoplasmic reticulum flavoprotein associated with degradation) | EBI-25770736 | 0.35 |
| Q8NBM4 | Ubiquitin-associated domain-containing protein 2 (UBA domain-containing protein 2) (Phosphoglycerate dehydrogenase-like protein 1) | EBI-25771384 | 0.35 |
| Q5U458 | DnaJ homolog subfamily C member 11 | EBI-26450034 | 0.35 |
| O60303 | Katanin-interacting protein | EBI-26582514 | 0.35 |
| P34972 | Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5) | EBI-26880846 | 0.35 |
| P01116 | GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed] | EBI-27041844 | 0.27 |
| P01111 | GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras) | EBI-27042293 | 0.27 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| A0A0H3NFP4 | SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity) | EBI-27055788 | 0.27 |
| A0A0H3NG92 | Type III secretion system effector protein-regulates and maintains the SCV (Type III secretion systems effector SseF) | EBI-27055968 | 0.27 |
| A0A0H3NF08 | SPI-2 type III secretion system effector PipB2 (Type III secretion system effector protein, Contributes to Sif formation) | EBI-27055973 | 0.27 |
| A0A0H3NB75 | Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV) | EBI-27055983 | 0.27 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27108918 | 0.35 |
| Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
| Q86UX6 | Serine/threonine-protein kinase 32C (EC 2.7.11.1) (PKE) (Yet another novel kinase 3) | EBI-28942129 | 0.35 |
| Q99986 | Serine/threonine-protein kinase VRK1 (EC 2.7.11.1) (Vaccinia-related kinase 1) | EBI-28944934 | 0.35 |
| Q9UJY1 | Heat shock protein beta-8 (HspB8) (Alpha-crystallin C chain) (E2-induced gene 1 protein) (Protein kinase H11) (Small stress protein-like protein HSP22) | EBI-28946841 | 0.35 |
| Q8NCK7 | Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11) | EBI-27103180 | 0.35 |
| Q93009 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-30841862 | 0.44 |
| Q05925 | Homeobox protein engrailed-1 (Homeobox protein en-1) (Hu-En-1) | EBI-29000369 | 0.35 |
| P23769 | Endothelial transcription factor GATA-2 (GATA-binding protein 2) | EBI-29000495 | 0.35 |
| P23771 | Trans-acting T-cell-specific transcription factor GATA-3 (GATA-binding factor 3) | EBI-29000509 | 0.35 |
| Q8TDD2 | Transcription factor Sp7 (Zinc finger protein osterix) | EBI-29000537 | 0.35 |
| P57682 | Krueppel-like factor 3 (Basic krueppel-like factor) (CACCC-box-binding protein BKLF) (TEF-2) | EBI-29000670 | 0.35 |
| P43694 | Transcription factor GATA-4 (GATA-binding factor 4) | EBI-29011567 | 0.35 |
| Q9UIH9 | Krueppel-like factor 15 (Kidney-enriched krueppel-like factor) | EBI-29019642 | 0.35 |
| Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.35 |
| O95600 | Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741) | EBI-29020196 | 0.35 |
| P48431 | Transcription factor SOX-2 | EBI-29373058 | 0.35 |
| P35712 | Transcription factor SOX-6 | EBI-29384845 | 0.35 |
| P08047 | Transcription factor Sp1 | EBI-29385496 | 0.35 |
| P31314 | T-cell leukemia homeobox protein 1 (Homeobox protein Hox-11) (Proto-oncogene TCL-3) (T-cell leukemia/lymphoma protein 3) | EBI-29607649 | 0.35 |
| O43763 | T-cell leukemia homeobox protein 2 (Homeobox protein Hox-11L1) (Neural crest homeobox protein) | EBI-29612789 | 0.35 |
| O43711 | T-cell leukemia homeobox protein 3 (Homeobox protein Hox-11L2) | EBI-29624592 | 0.35 |
| P52952 | Homeobox protein Nkx-2.5 (Cardiac-specific homeobox) (Homeobox protein CSX) (Homeobox protein NK-2 homolog E) | EBI-29653951 | 0.35 |
| Q9Y4X4 | Krueppel-like factor 12 (Transcriptional repressor AP-2rep) | EBI-29017631 | 0.27 |
| P21709 | Ephrin type-A receptor 1 (hEpha1) (EC 2.7.10.1) (EPH tyrosine kinase) (EPH tyrosine kinase 1) (Erythropoietin-producing hepatoma receptor) (Tyrosine-protein kinase receptor EPH) | EBI-32717758 | 0.35 |
| P29322 | Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK) | EBI-32718189 | 0.42 |
| P22455 | Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334) | EBI-32718547 | 0.35 |
| P35916 | Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4) | EBI-32718614 | 0.35 |
| P08069 | Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] | EBI-32718669 | 0.42 |
| P06213 | Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta] | EBI-32718777 | 0.42 |
| P08581 | Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto-oncogene c-Met) (Scatter factor receptor) (SF receptor) (Tyrosine-protein kinase Met) | EBI-32719056 | 0.42 |
| P04629 | High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA) | EBI-32719115 | 0.35 |
| Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32719212 | 0.35 |
| Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2) | EBI-32719482 | 0.42 |
| Q6J9G0 | Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1) | EBI-32719662 | 0.42 |
| Q06418 | Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF) | EBI-32719716 | 0.35 |
| Q9UM73 | ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246) | EBI-32719830 | 0.27 |
| P30530 | Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene) | EBI-32719959 | 0.27 |
| P21860 | Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3) | EBI-32721529 | 0.27 |
| P22607 | Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333) | EBI-32721979 | 0.27 |
| P17948 | Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor) | EBI-32722433 | 0.27 |
| P36888 | Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135) | EBI-32722567 | 0.27 |
| P14616 | Insulin receptor-related protein (IRR) (EC 2.7.10.1) (IR-related receptor) [Cleaved into: Insulin receptor-related protein alpha chain; Insulin receptor-related protein beta chain] | EBI-32723232 | 0.27 |
| P35968 | Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309) | EBI-32723270 | 0.27 |
| Q8IWU2 | Serine/threonine-protein kinase LMTK2 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase 2) (Brain-enriched kinase) (hBREK) (CDK5/p35-regulated kinase) (CPRK) (Kinase/phosphatase/inhibitor 2) (Lemur tyrosine kinase 2) (Serine/threonine-protein kinase KPI-2) | EBI-32723604 | 0.27 |
| Q12866 | Tyrosine-protein kinase Mer (EC 2.7.10.1) (Proto-oncogene c-Mer) (Receptor tyrosine kinase MerTK) | EBI-32723870 | 0.27 |
| O15146 | Muscle, skeletal receptor tyrosine-protein kinase (EC 2.7.10.1) (Muscle-specific tyrosine-protein kinase receptor) (MuSK) (Muscle-specific kinase receptor) | EBI-32724025 | 0.27 |
| P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-32725031 | 0.27 |
| P08922 | Proto-oncogene tyrosine-protein kinase ROS (EC 2.7.10.1) (Proto-oncogene c-Ros) (Proto-oncogene c-Ros-1) (Receptor tyrosine kinase c-ros oncogene 1) (c-Ros receptor tyrosine kinase) | EBI-32731758 | 0.27 |
| Q02763 | Angiopoietin-1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains-2) (Tyrosine-protein kinase receptor TEK) (Tyrosine-protein kinase receptor TIE-2) (hTIE2) (p140 TEK) (CD antigen CD202b) | EBI-32732012 | 0.35 |
| Q8N612 | FHF complex subunit HOOK interacting protein 1B (FHIP1B) (FTS and Hook-interacting protein) (FHIP) | EBI-34574737 | 0.27 |
| Q5W0V3 | FHF complex subunit HOOK interacting protein 2A (FHIP2A) | EBI-34574999 | 0.27 |
Database | Links |
| UNIPROT | P50402 Q6FI02 |
| PDB | 1JEI 2ODC 2ODG 6GHD 6RPR 7NDY |
| Pfam | PF03020 |
| PROSITE | PS50954 |
| OMIM | 300384 310300 |
| DisGeNET | 2010 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory