Protein Information |
|
|---|---|
| Protein Name | Calcium homeostasis endoplasmic reticulum protein |
| Accession Code | Q8IWX8 |
| Gene | CHERP |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 916) | |
|
MEMPLPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQLICKQQTPELEPAATMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQEQHLLALRQEQ VTAAVAHAVEQQMQKLLEETQLDMNEFDNLLQPIIDTCTKDAISAGKNWMFSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKI ARLLQLWEKNGYFDDSIIQQLQSPALGLGQYQATLINEYSSVVQPVQLAFQQQIQTLKTQHEEFVTSLAQQQQQQQQQQQQLQMPQMEAEVKATPPPPAPPPAPAPAPAIPPTTQPDDSKPPIQMPGSSE YEAPGGVQDPAAAGPRGPGPHDQIPPNKPPWFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAPWNNQPDAAWNSQFEGPWNSQHEQPPWGGGQREPPFRMQRPP HFRGPFPPHQQHPQFNQPPHPHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPAEMGPPHHHPGHRMPHPGINEHPPWAGPQHPDFGPPPHGFNGQPPHMRRQGPPHINHDDPSLVPNVPYFDL PAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSNSRSSKSSGSYSRSRSRSCSRSYSRSR SRSRSRSRSSRSRSRSQSRSRSKSYSPGRRRRSRSRSPTPPSSAGLGSNSAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMK ARDECK |
|
Description |
|
|---|---|
| Involved in calcium homeostasis, growth and proliferation. {Experimental EvidencePubMed:10794731, Experimental EvidencePubMed:12656674}. | Assigned Ontology terms |
| Biological Process | Cellular Calcium Ion Homeostasis (GO:0006874) Negative Regulation Of Cell Population Proliferation (GO:0008285) Nervous System Development (GO:0007399) Positive Regulation Of Calcineurin-NFAT Signaling Cascade (GO:0070886) Release Of Sequestered Calcium Ion Into Cytosol (GO:0051209) RNA Processing (GO:0006396) |
| Molecular Function | RNA Binding (GO:0003723) Transmembrane Transporter Binding (GO:0044325) |
Interactions with Nuclear Envelope proteins (5 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O43542 | DNA repair protein XRCC3 | EBI-11129266 | 0.35 |
| O75716 | Serine/threonine-protein kinase 16 | EBI-28931389 | 0.35 |
| P07948 | Tyrosine-protein kinase Lyn | EBI-25390944 | 0.35 |
| P63244 | Receptor of activated protein C kinase 1, N-terminally processed | EBI-7723227 | 0.37 |
| Q8IX12 | Cell division cycle and apoptosis regulator protein 1 | EBI-7721515 | 0.37 | Interactions with other proteins (82 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| O75554 | WW domain-binding protein 4 (WBP-4) (Formin-binding protein 21) (WW domain-containing-binding protein 4) | EBI-7722318 | 0.40 |
| Q8K4Z5 | Splicing factor 3A subunit 1 (SF3a120) | EBI-2555364 | 0.40 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| P31016 | Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90) | EBI-7958999 | 0.44 |
| Q01844 | RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) | EBI-3935753 | 0.37 |
| P26368 | Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (hU2AF(65)) (hU2AF65) (U2 snRNP auxiliary factor large subunit) | EBI-7704096 | 0.51 |
| Q14562 | ATP-dependent RNA helicase DHX8 (EC 3.6.4.13) (DEAH box protein 8) (RNA helicase HRH1) | EBI-7704116 | 0.51 |
| Q8WVK2 | U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein (U4/U6.U5 snRNP 27 kDa protein) (U4/U6.U5-27K) (Nucleic acid-binding protein RY-1) (U4/U6.U5 tri-snRNP-associated 27 kDa protein) (27K) (U4/U6.U5 tri-snRNP-associated protein 3) | EBI-7704173 | 0.51 |
| Q70Z53 | Protein FRA10AC1 | EBI-7704153 | 0.51 |
| Q9NQ29 | Putative RNA-binding protein Luc7-like 1 (Putative SR protein LUC7B1) (SR+89) | EBI-7704193 | 0.51 |
| P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-7708765 | 0.37 |
| O75400 | Pre-mRNA-processing factor 40 homolog A (Fas ligand-associated factor 1) (Formin-binding protein 11) (Formin-binding protein 3) (Huntingtin yeast partner A) (Huntingtin-interacting protein 10) (HIP-10) (Huntingtin-interacting protein A) (Renal carcinoma antigen NY-REN-6) | EBI-7711561 | 0.37 |
| Q15427 | Splicing factor 3B subunit 4 (Pre-mRNA-splicing factor SF3b 49 kDa subunit) (Spliceosome-associated protein 49) (SAP 49) | EBI-7716078 | 0.37 |
| Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | EBI-7719282 | 0.37 |
| Q86U06 | Probable RNA-binding protein 23 (CAPER beta) (CAPERbeta) (RNA-binding motif protein 23) (RNA-binding region-containing protein 4) (Splicing factor SF2) | EBI-7721614 | 0.37 |
| Q14498 | RNA-binding protein 39 (CAPER alpha) (CAPERalpha) (Hepatocellular carcinoma protein 1) (RNA-binding motif protein 39) (RNA-binding region-containing protein 2) (Splicing factor HCC1) | EBI-7721713 | 0.37 |
| O43290 | U4/U6.U5 tri-snRNP-associated protein 1 (SNU66 homolog) (hSnu66) (Squamous cell carcinoma antigen recognized by T-cells 1) (SART-1) (hSART-1) (U4/U6.U5 tri-snRNP-associated 110 kDa protein) (allergen Hom s 1) | EBI-7721793 | 0.37 |
| Q8NAV1 | Pre-mRNA-splicing factor 38A | EBI-7721925 | 0.37 |
| Q8TAD8 | Smad nuclear-interacting protein 1 (FHA domain-containing protein SNIP1) | EBI-7722081 | 0.37 |
| Q15287 | RNA-binding protein with serine-rich domain 1 (SR-related protein LDC2) | EBI-7722240 | 0.37 |
| Q9Y580 | RNA-binding protein 7 (RNA-binding motif protein 7) | EBI-7722477 | 0.37 |
| Q9NWB6 | Arginine and glutamate-rich protein 1 | EBI-7722538 | 0.37 |
| Q8N302 | Angiogenic factor with G patch and FHA domains 1 (Angiogenic factor VG5Q) (hVG5Q) (G patch domain-containing protein 7) (Vasculogenesis gene on 5q protein) | EBI-7722635 | 0.37 |
| Q8WUA2 | Peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) (EC 5.2.1.8) (Cyclophilin-like protein PPIL4) (Rotamase PPIL4) | EBI-7722733 | 0.37 |
| P31942 | Heterogeneous nuclear ribonucleoprotein H3 (hnRNP H3) (Heterogeneous nuclear ribonucleoprotein 2H9) (hnRNP 2H9) | EBI-7722992 | 0.37 |
| Q96N46 | Tetratricopeptide repeat protein 14 (TPR repeat protein 14) | EBI-7723120 | 0.37 |
| P78362 | SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal] | EBI-6658253 | 0.44 |
| Q96SB4 | SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1) | EBI-6660503 | 0.44 |
| O43143 | ATP-dependent RNA helicase DHX15 (EC 3.6.4.13) (ATP-dependent RNA helicase #46) (DEAH box protein 15) (Splicing factor Prp43) (hPrp43) | EBI-9246997 | 0.53 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-9660150 | 0.44 |
| Q15637 | Splicing factor 1 (Mammalian branch point-binding protein) (BBP) (mBBP) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Zinc finger protein 162) | EBI-11297492 | 0.58 |
| E9PUA5 | Kinesin-like protein | EBI-10999661 | 0.35 |
| O00159 | Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb) | EBI-11030803 | 0.35 |
| Q9ULU4 | Protein kinase C-binding protein 1 (Cutaneous T-cell lymphoma-associated antigen se14-3) (CTCL-associated antigen se14-3) (Rack7) (Zinc finger MYND domain-containing protein 8) | EBI-11059997 | 0.35 |
| P09450 | Transcription factor JunB (MyD21) (Transcription factor AP-1 subunit JunB) | EBI-11127973 | 0.35 |
| Q15006 | ER membrane protein complex subunit 2 (Tetratricopeptide repeat protein 35) (TPR repeat protein 35) | EBI-11130215 | 0.35 |
| Q12899 | Tripartite motif-containing protein 26 (EC 2.3.2.27) (Acid finger protein) (AFP) (RING finger protein 95) (Zinc finger protein 173) | EBI-11135299 | 0.35 |
| P16070 | CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44) | EBI-11137406 | 0.35 |
| Q9UJV9 | Probable ATP-dependent RNA helicase DDX41 (EC 3.6.4.13) (DEAD box protein 41) (DEAD box protein abstrakt homolog) | EBI-11473486 | 0.35 |
| Q5HY92 | Fidgetin | EBI-24281098 | 0.56 |
| Q14847 | LIM and SH3 domain protein 1 (LASP-1) (Metastatic lymph node gene 50 protein) (MLN 50) | EBI-24325847 | 0.56 |
| Q04726 | Transducin-like enhancer protein 3 (Enhancer of split groucho-like protein 3) (ESG3) | EBI-24332621 | 0.56 |
| Q8IYX7 | Stabilizer of axonemal microtubules 1 | EBI-24335366 | 0.56 |
| Q6P1W5 | Uncharacterized protein C1orf94 | EBI-24340482 | 0.56 |
| Q6UY14 | ADAMTS-like protein 4 (ADAMTSL-4) (Thrombospondin repeat-containing protein 1) | EBI-24343283 | 0.56 |
| O43251 | RNA binding protein fox-1 homolog 2 (Fox-1 homolog B) (Hexaribonucleotide-binding protein 2) (RNA-binding motif protein 9) (RNA-binding protein 9) (Repressor of tamoxifen transcriptional activity) | EBI-24345250 | 0.56 |
| Q8IUC1 | Keratin-associated protein 11-1 (High sulfur keratin-associated protein 11.1) | EBI-24616416 | 0.56 |
| Q9Y5V3 | Melanoma-associated antigen D1 (MAGE tumor antigen CCF) (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog) | EBI-24375990 | 0.56 |
| O60504 | Vinexin (SH3-containing adapter molecule 1) (SCAM-1) (Sorbin and SH3 domain-containing protein 3) | EBI-24405530 | 0.56 |
| Q70EL1 | Inactive ubiquitin carboxyl-terminal hydrolase 54 (Inactive ubiquitin-specific peptidase 54) | EBI-25260374 | 0.56 |
| Q14296 | Fas-activated serine/threonine kinase (FAST kinase) (EC 2.7.11.1) (EC 2.7.11.8) | EBI-24435404 | 0.56 |
| P49761 | Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3) | EBI-25179685 | 0.56 |
| P36817 | Protein E7 | EBI-26508164 | 0.37 |
| P06423 | Regulatory protein E2 | EBI-16046574 | 0.49 |
| P06921 | Regulatory protein E2 | EBI-16047171 | 0.00 |
| P06422 | Regulatory protein E2 | EBI-16048319 | 0.00 |
| P36780 | Regulatory protein E2 | EBI-16049196 | 0.00 |
| P62136 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-14025896 | 0.42 |
| P22492 | Histone H1t (Testicular H1 histone) | EBI-21580683 | 0.35 |
| Q02809 | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (EC 1.14.11.4) (Lysyl hydroxylase 1) (LH1) | EBI-21585081 | 0.35 |
| Q96P53 | WD repeat and FYVE domain-containing protein 2 (Propeller-FYVE protein) (Prof) (WD40- and FYVE domain-containing protein 2) (Zinc finger FYVE domain-containing protein 22) | EBI-21607501 | 0.35 |
| P55075 | Fibroblast growth factor 8 (FGF-8) (Androgen-induced growth factor) (AIGF) (Heparin-binding growth factor 8) (HBGF-8) | EBI-21635166 | 0.35 |
| P15880 | 40S ribosomal protein S2 (40S ribosomal protein S4) (Protein LLRep3) (Small ribosomal subunit protein uS5) | EBI-21677299 | 0.35 |
| P62304 | Small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E) (Sm-E) (SmE) | EBI-21697668 | 0.35 |
| P21802 | Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332) | EBI-21718282 | 0.35 |
| Q15696 | U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 (CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2) (Renal carcinoma antigen NY-REN-20) (U2(RNU2) small nuclear RNA auxiliary factor 1-like 2) (U2AF35-related protein) (URP) | EBI-21718626 | 0.35 |
| Q6NYC1 | Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 (EC 1.14.11.-) (Histone arginine demethylase JMJD6) (JmjC domain-containing protein 6) (Jumonji domain-containing protein 6) (Lysyl-hydroxylase JMJD6) (Peptide-lysine 5-dioxygenase JMJD6) (Phosphatidylserine receptor) (Protein PTDSR) | EBI-21718825 | 0.35 |
| Q96I25 | Splicing factor 45 (45 kDa-splicing factor) (RNA-binding motif protein 17) | EBI-21719204 | 0.35 |
| P62241 | 40S ribosomal protein S8 (Small ribosomal subunit protein eS8) | EBI-21741627 | 0.35 |
| Q6ZNJ1 | Neurobeachin-like protein 2 | EBI-16749633 | 0.35 |
| O15042 | U2 snRNP-associated SURP motif-containing protein (140 kDa Ser/Arg-rich domain protein) (U2-associated protein SR140) | EBI-20925834 | 0.40 |
| P07947 | Tyrosine-protein kinase Yes (EC 2.7.10.2) (Proto-oncogene c-Yes) (p61-Yes) | EBI-25390545 | 0.35 |
| Q09161 | Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit) | EBI-26396507 | 0.35 |
| Q53F19 | Nuclear cap-binding protein subunit 3 (Protein ELG) | EBI-26396827 | 0.35 |
| P52298 | Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1) | EBI-26398473 | 0.35 |
| P14240 | RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (Large structural protein) (Replicase) (Transcriptase) [Includes: cap-snatching endonuclease (EC 3.1.-.-)] | EBI-26968430 | 0.35 |
| Q13363 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) | EBI-27046166 | 0.35 |
| P27361 | Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (Microtubule-associated protein 2 kinase) (p44-ERK1) | EBI-28934804 | 0.35 |
| Q15208 | Serine/threonine-protein kinase 38 (EC 2.7.11.1) (NDR1 protein kinase) (Nuclear Dbf2-related kinase 1) | EBI-28941263 | 0.35 |
| Q96BR1 | Serine/threonine-protein kinase Sgk3 (EC 2.7.11.1) (Cytokine-independent survival kinase) (Serum/glucocorticoid-regulated kinase 3) (Serum/glucocorticoid-regulated kinase-like) | EBI-28944277 | 0.35 |
| Q9Y2H9 | Microtubule-associated serine/threonine-protein kinase 1 (EC 2.7.11.1) (Syntrophin-associated serine/threonine-protein kinase) | EBI-28948459 | 0.35 |
Database | Links |
| UNIPROT | Q8IWX8 O00302 Q4G0Y5 Q8WU30 Q99492 |
| Pfam | PF04818 PF01585 PF01805 |
| PROSITE | PS51391 PS50174 PS50128 |
| OMIM | 618539 |
| DisGeNET | 10523 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory