Protein Information |
|
|---|---|
| Protein Name | DNA repair protein XRCC3 |
| Accession Code | O43542 |
| Gene | XRCC3 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 346) | |
|
MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH GGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVT EAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH |
|
Description |
||
|---|---|---|
| Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Mitochondrion. Note=Accumulates in discrete nuclear foci prior to DNA damage, and these foci persist throughout the time course of DNA repair. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Chromosome, Telomeric Region (GO:0000781) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Mitochondrion (GO:0005739) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Rad51C-XRCC3 Complex (GO:0033065) Replication Fork (GO:0005657) |
|
Description |
|
|---|---|
| Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the RAD51 paralog protein complex CX3 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, CX3 acts downstream of RAD51 recruitment; the complex binds predominantly to the intersection of the four duplex arms of the Holliday junction (HJ) and to junctions of replication forks. Involved in HJ resolution and thus in processing HR intermediates late in the DNA repair process; the function may be linked to the CX3 complex and seems to involve GEN1 during mitotic cell cycle progression. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C. {Experimental EvidencePubMed:14716019, Experimental EvidencePubMed:20413593, Experimental EvidencePubMed:23108668, Experimental EvidencePubMed:23149936}. | Assigned Ontology terms |
| Biological Process | Cellular Response To DNA Damage Stimulus (GO:0006974) DNA Recombination (GO:0006310) DNA Repair (GO:0006281) Double-Strand Break Repair Via Homologous Recombination (GO:0000724) Double-Strand Break Repair Via Synthesis-Dependent Strand Annealing (GO:0045003) Interstrand Cross-Link Repair (GO:0036297) Positive Regulation Of Mitotic Cell Cycle Spindle Assembly Checkpoint (GO:0090267) Regulation Of Centrosome Duplication (GO:0010824) Resolution Of Mitotic Recombination Intermediates (GO:0071140) Response To Organic Substance (GO:0010033) T-Circle Formation (GO:0090656) Telomere Maintenance Via Recombination (GO:0000722) Telomere Maintenance Via Telomere Trimming (GO:0090737) Telomeric Loop Disassembly (GO:0090657) |
| Molecular Function | ATP Binding (GO:0005524) ATP-Dependent DNA Damage Sensor Activity (GO:0140664) DNA Binding (GO:0003677) |
Description |
|
|---|---|
| Breast cancer (BC) [MIM:114480]: A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. {Experimental EvidencePubMed:12023982}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. Melanoma, cutaneous malignant 6 (CMM6) [MIM:613972]: A malignant neoplasm of melanocytes, arising de novo or from a pre- existing benign nevus, which occurs most often in the skin but may also involve other sites. {Experimental EvidencePubMed:11059748}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. | Database Associations |
| OMIM | 114480 600675 613972 |
| DisGeNET | 7517 |
Interactions with Nuclear Envelope proteins (15 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q8IX12 | Cell division cycle and apoptosis regulator protein 1 | EBI-11129266 | 0.35 |
| Q9Y6K0 | Choline/ethanolaminephosphotransferase 1 | EBI-11129266 | 0.35 |
| Q8IWX8 | Calcium homeostasis endoplasmic reticulum protein | EBI-11129266 | 0.35 |
| Q07065 | Cytoskeleton-associated protein 4 | EBI-11129266 | 0.35 |
| P31689 | DnaJ homolog subfamily A member 1 | EBI-11129266 | 0.35 |
| Q96RT1 | Erbin | EBI-11129266 | 0.35 |
| Q8TAG9 | Exocyst complex component 6 | EBI-11129266 | 0.35 |
| O00165 | HCLS1-associated protein X-1 | EBI-11129266 | 0.35 |
| P42167 | Thymopentin | EBI-11129266 | 0.35 |
| Q9NZM1 | Myoferlin | EBI-11129266 | 0.35 |
| Q8N1F7 | Nuclear pore complex protein Nup93 | EBI-11129266 | 0.35 |
| O43502 | DNA repair protein RAD51 homolog 3 | EBI-9119744 | 0.94 |
| Q06609 | DNA repair protein RAD51 homolog 1 | EBI-9249126 | 0.73 |
| Q8NFQ8 | Torsin-1A-interacting protein 2 | EBI-21508086 | 0.35 |
| Q9H3U1 | Protein unc-45 homolog A | EBI-11129266 | 0.35 | Interactions with other proteins (134 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q8ZAN0 | Fatty acid oxidation complex subunit alpha [Includes: Enoyl-CoA hydratase/Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase (EC 4.2.1.17) (EC 5.1.2.3) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)] | EBI-2849986 | 0.00 |
| A0A380PDY1 | Oligogalacturonate lyase (EC 4.2.2.6) | EBI-2849973 | 0.00 |
| Q6NVH7 | ATPase SWSAP1 (SWIM-type zinc finger 7-associated protein 1) (SWS1-associated protein 1) (ZSWIM7-associated protein 1) (ZSWIM7AP1) | EBI-5282263 | 0.52 |
| Q19AV6 | Zinc finger SWIM domain-containing protein 7 (SWIM domain-containing and Srs2-interacting protein 1 homolog) (SWIM-type zinc finger domain-containing protein 7) | EBI-5282291 | 0.40 |
| Q9H6U6 | BCAS3 microtubule associated cell migration factor (Breast carcinoma-amplified sequence 3) (GAOB1) | EBI-9071268 | 0.37 |
| P09341 | Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-alpha(5-73); GRO-alpha(6-73)] | EBI-9071281 | 0.37 |
| Q96KN1 | Protein LRATD2 (Breast cancer membrane protein 101) (LRAT domain-containing 2) (Protein FAM84B) (Protein NSE2) | EBI-9071294 | 0.37 |
| Q4ZG55 | Protein GREB1 (Gene regulated in breast cancer 1 protein) | EBI-9071307 | 0.37 |
| Q86UX2 | Inter-alpha-trypsin inhibitor heavy chain H5 (ITI heavy chain H5) (ITI-HC5) (Inter-alpha-inhibitor heavy chain 5) | EBI-9071320 | 0.37 |
| Q9UBG0 | C-type mannose receptor 2 (C-type lectin domain family 13 member E) (Endocytic receptor 180) (Macrophage mannose receptor 2) (Urokinase-type plasminogen activator receptor-associated protein) (UPAR-associated protein) (Urokinase receptor-associated protein) (CD antigen CD280) | EBI-9071333 | 0.37 |
| Q9UJX0 | Oxidative stress-induced growth inhibitor 1 (Bone marrow stromal cell-derived growth inhibitor) (BMSC-derived growth inhibitor) (Ovary, kidney and liver protein 38) (huOKL38) (Pregnancy-induced growth inhibitor OKL38) | EBI-9071346 | 0.37 |
| Q9P2W1 | Homologous-pairing protein 2 homolog (Nuclear receptor coactivator GT198) (PSMC3-interacting protein) (Proteasome 26S ATPase subunit 3-interacting protein) (Tat-binding protein 1-interacting protein) (TBP-1-interacting protein) | EBI-9071359 | 0.37 |
| Q92560 | Ubiquitin carboxyl-terminal hydrolase BAP1 (EC 3.4.19.12) (BRCA1-associated protein 1) (Cerebral protein 6) | EBI-9071372 | 0.37 |
| Q5VTR2 | E3 ubiquitin-protein ligase BRE1A (BRE1-A) (hBRE1) (EC 2.3.2.27) (RING finger protein 20) (RING-type E3 ubiquitin transferase BRE1A) | EBI-9071385 | 0.37 |
| Q96QR1 | Secretoglobin family 3A member 1 (Cytokine HIN-1) (High in normal 1) (Pneumo secretory protein 2) (PnSP-2) (Uteroglobin-related protein 2) | EBI-9071398 | 0.37 |
| P36952 | Serpin B5 (Maspin) (Peptidase inhibitor 5) (PI-5) | EBI-9071411 | 0.37 |
| O95863 | Zinc finger protein SNAI1 (Protein snail homolog 1) (Protein sna) | EBI-9071424 | 0.37 |
| P04155 | Trefoil factor 1 (Breast cancer estrogen-inducible protein) (PNR-2) (Polypeptide P1.A) (hP1.A) (Protein pS2) | EBI-9071437 | 0.37 |
| Q14258 | E3 ubiquitin/ISG15 ligase TRIM25 (EC 6.3.2.n3) (Estrogen-responsive finger protein) (RING finger protein 147) (RING-type E3 ubiquitin transferase) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM25) (Tripartite motif-containing protein 25) (Ubiquitin/ISG15-conjugating enzyme TRIM25) (Zinc finger protein 147) | EBI-9071451 | 0.37 |
| Q86YC2 | Partner and localizer of BRCA2 | EBI-9119744 | 0.58 |
| P51587 | Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein) | EBI-9119744 | 0.53 |
| O43264 | Centromere/kinetochore protein zw10 homolog | EBI-11129266 | 0.35 |
| Q9C0C2 | 182 kDa tankyrase-1-binding protein | EBI-11129266 | 0.35 |
| Q9BVQ7 | Ribosome biogenesis protein SPATA5L1 (EC 3.6.4.10) (Spermatogenesis-associated protein 5-like protein 1) | EBI-11129266 | 0.35 |
| P49368 | T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5) | EBI-11129266 | 0.35 |
| O14579 | Coatomer subunit epsilon (Epsilon-coat protein) (Epsilon-COP) | EBI-11129266 | 0.35 |
| P12268 | Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (Inosine-5'-monophosphate dehydrogenase type II) (IMP dehydrogenase II) (IMPDH-II) | EBI-11129266 | 0.35 |
| Q9HDC5 | Junctophilin-1 (JP-1) (Junctophilin type 1) | EBI-11129266 | 0.35 |
| Q9BWM7 | Sideroflexin-3 | EBI-11129266 | 0.35 |
| Q8N302 | Angiogenic factor with G patch and FHA domains 1 (Angiogenic factor VG5Q) (hVG5Q) (G patch domain-containing protein 7) (Vasculogenesis gene on 5q protein) | EBI-11129266 | 0.35 |
| Q13435 | Splicing factor 3B subunit 2 (Pre-mRNA-splicing factor SF3b 145 kDa subunit) (SF3b145) (Spliceosome-associated protein 145) (SAP 145) | EBI-11129266 | 0.35 |
| Q96P70 | Importin-9 (Imp9) (Ran-binding protein 9) (RanBP9) | EBI-11129266 | 0.35 |
| Q9H840 | Gem-associated protein 7 (Gemin-7) (SIP3) | EBI-11129266 | 0.35 |
| Q8WVB6 | Chromosome transmission fidelity protein 18 homolog (hCTF18) (CHL12) | EBI-11129266 | 0.35 |
| Q86UP2 | Kinectin (CG-1 antigen) (Kinesin receptor) | EBI-11129266 | 0.35 |
| P16615 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) | EBI-11129266 | 0.35 |
| O60220 | Mitochondrial import inner membrane translocase subunit Tim8 A (Deafness dystonia protein 1) (X-linked deafness dystonia protein) | EBI-11129266 | 0.35 |
| Q15293 | Reticulocalbin-1 | EBI-11129266 | 0.35 |
| Q9NVC6 | Mediator of RNA polymerase II transcription subunit 17 (Activator-recruited cofactor 77 kDa component) (ARC77) (Cofactor required for Sp1 transcriptional activation subunit 6) (CRSP complex subunit 6) (Mediator complex subunit 17) (Thyroid hormone receptor-associated protein complex 80 kDa component) (Trap80) (Transcriptional coactivator CRSP77) (Vitamin D3 receptor-interacting protein complex 80 kDa component) (DRIP80) | EBI-11129266 | 0.35 |
| F8W038 | Chromosome 17 open reading frame 49 | EBI-11129266 | 0.35 |
| P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-11129266 | 0.35 |
| P17987 | T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) | EBI-11129266 | 0.35 |
| O94822 | E3 ubiquitin-protein ligase listerin (EC 2.3.2.27) (RING finger protein 160) (RING-type E3 ubiquitin transferase listerin) (Zinc finger protein 294) | EBI-11129266 | 0.35 |
| Q96CT7 | Coiled-coil domain-containing protein 124 | EBI-11129266 | 0.35 |
| Q9NZ01 | Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER) | EBI-11129266 | 0.35 |
| Q9H9B4 | Sideroflexin-1 | EBI-11129266 | 0.35 |
| P47897 | Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS) | EBI-11129266 | 0.35 |
| Q99570 | Phosphoinositide 3-kinase regulatory subunit 4 (PI3-kinase regulatory subunit 4) (EC 2.7.11.1) (PI3-kinase p150 subunit) (Phosphoinositide 3-kinase adaptor protein) | EBI-11129266 | 0.35 |
| B4E1G1 | Derlin | EBI-11129266 | 0.35 |
| P98175 | RNA-binding protein 10 (G patch domain-containing protein 9) (RNA-binding motif protein 10) (RNA-binding protein S1-1) (S1-1) | EBI-11129266 | 0.35 |
| F8W7C6 | 60S ribosomal protein L10 | EBI-11129266 | 0.35 |
| Q96BD0 | Solute carrier organic anion transporter family member 4A1 (OATP4A1) (Colon organic anion transporter) (Organic anion transporter polypeptide-related protein 1) (OATP-RP1) (OATPRP1) (POAT) (Organic anion-transporting polypeptide E) (OATP-E) (Sodium-independent organic anion transporter E) (Solute carrier family 21 member 12) | EBI-11129266 | 0.35 |
| P31327 | Carbamoyl-phosphate synthase [ammonia], mitochondrial (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) | EBI-11129266 | 0.35 |
| O75152 | Zinc finger CCCH domain-containing protein 11A | EBI-11129266 | 0.35 |
| P20839 | Inosine-5'-monophosphate dehydrogenase 1 (IMP dehydrogenase 1) (IMPD 1) (IMPDH 1) (EC 1.1.1.205) (IMPDH-I) | EBI-11129266 | 0.35 |
| O60524 | Ribosome quality control complex subunit NEMF (Antigen NY-CO-1) (Nuclear export mediator factor) (Serologically defined colon cancer antigen 1) | EBI-11129266 | 0.35 |
| P22626 | Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1) | EBI-11129266 | 0.35 |
| Q9Y2X0 | Mediator of RNA polymerase II transcription subunit 16 (Mediator complex subunit 16) (Thyroid hormone receptor-associated protein 5) (Thyroid hormone receptor-associated protein complex 95 kDa component) (Trap95) (Vitamin D3 receptor-interacting protein complex 92 kDa component) (DRIP92) | EBI-11129266 | 0.35 |
| Q86UK7 | E3 ubiquitin-protein ligase ZNF598 (EC 2.3.2.27) (Zinc finger protein 598) | EBI-11129266 | 0.35 |
| O95071 | E3 ubiquitin-protein ligase UBR5 (EC 2.3.2.26) (E3 ubiquitin-protein ligase, HECT domain-containing 1) (HECT-type E3 ubiquitin transferase UBR5) (Hyperplastic discs protein homolog) (hHYD) (Progestin-induced protein) | EBI-11129266 | 0.35 |
| Q14152 | Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) | EBI-11129266 | 0.35 |
| O00303 | Eukaryotic translation initiation factor 3 subunit F (eIF3f) (Deubiquitinating enzyme eIF3f) (EC 3.4.19.12) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47) | EBI-11129266 | 0.35 |
| O60841 | Eukaryotic translation initiation factor 5B (eIF-5B) (EC 3.6.5.3) (Translation initiation factor IF-2) | EBI-11129266 | 0.35 |
| Q99707 | Methionine synthase (MS) (EC 2.1.1.13) (5-methyltetrahydrofolate--homocysteine methyltransferase) (Cobalamin-dependent methionine synthase) (Vitamin-B12 dependent methionine synthase) | EBI-11129266 | 0.35 |
| P54278 | Mismatch repair endonuclease PMS2 (EC 3.1.-.-) (DNA mismatch repair protein PMS2) (PMS1 protein homolog 2) | EBI-11129266 | 0.35 |
| Q15758 | Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5) | EBI-11129266 | 0.35 |
| Q92973 | Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP) | EBI-11129266 | 0.35 |
| O14949 | Cytochrome b-c1 complex subunit 8 (Complex III subunit 8) (Complex III subunit VIII) (Ubiquinol-cytochrome c reductase complex 9.5 kDa protein) (Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C) | EBI-11129266 | 0.35 |
| Q96D15 | Reticulocalbin-3 (EF-hand calcium-binding protein RLP49) | EBI-11129266 | 0.35 |
| Q9NS69 | Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog) | EBI-11129266 | 0.53 |
| P51798 | H(+)/Cl(-) exchange transporter 7 (Chloride channel 7 alpha subunit) (Chloride channel protein 7) (ClC-7) | EBI-11129266 | 0.35 |
| O75477 | Erlin-1 (Endoplasmic reticulum lipid raft-associated protein 1) (Protein KE04) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (SPFH domain-containing protein 1) | EBI-11129266 | 0.35 |
| Q14318 | Peptidyl-prolyl cis-trans isomerase FKBP8 (PPIase FKBP8) (EC 5.2.1.8) (38 kDa FK506-binding protein) (38 kDa FKBP) (FKBP-38) (hFKBP38) (FK506-binding protein 8) (FKBP-8) (FKBPR38) (Rotamase) | EBI-11129266 | 0.35 |
| O43852 | Calumenin (Crocalbin) (IEF SSP 9302) | EBI-11129266 | 0.35 |
| Q9UI10 | Translation initiation factor eIF-2B subunit delta (eIF-2B GDP-GTP exchange factor subunit delta) | EBI-11129266 | 0.35 |
| P06746 | DNA polymerase beta (EC 2.7.7.7) (EC 4.2.99.-) | EBI-11129266 | 0.35 |
| Q9HCN4 | GPN-loop GTPase 1 (EC 3.6.5.-) (MBD2-interacting protein) (MBDin) (RNAPII-associated protein 4) (XPA-binding protein 1) | EBI-11129266 | 0.35 |
| Q15459 | Splicing factor 3A subunit 1 (SF3a120) (Spliceosome-associated protein 114) (SAP 114) | EBI-11129266 | 0.35 |
| Q8WW12 | PEST proteolytic signal-containing nuclear protein (PCNP) (PEST-containing nuclear protein) | EBI-11129266 | 0.35 |
| O75448 | Mediator of RNA polymerase II transcription subunit 24 (Activator-recruited cofactor 100 kDa component) (ARC100) (Cofactor required for Sp1 transcriptional activation subunit 4) (CRSP complex subunit 4) (Mediator complex subunit 24) (Thyroid hormone receptor-associated protein 4) (Thyroid hormone receptor-associated protein complex 100 kDa component) (Trap100) (hTRAP100) (Vitamin D3 receptor-interacting protein complex 100 kDa component) (DRIP100) | EBI-11129266 | 0.35 |
| Q99942 | E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (RING finger protein 5) (Ram1 homolog) (HsRma1) | EBI-11129266 | 0.35 |
| Q969V3 | Nicalin (Nicastrin-like protein) | EBI-11129266 | 0.35 |
| Q9UJS0 | Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial (Calcium-binding mitochondrial carrier protein Aralar2) (ARALAR-related gene 2) (ARALAR2) (Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) | EBI-11129266 | 0.35 |
| Q99623 | Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity) | EBI-11129266 | 0.35 |
| C9JA28 | Translocon-associated protein subunit gamma (Signal sequence receptor subunit gamma) | EBI-11129266 | 0.35 |
| Q9H3F6 | BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 (hBACURD3) (BTB/POZ domain-containing protein KCTD10) (Potassium channel tetramerization domain-containing protein 10) | EBI-11129266 | 0.35 |
| Q9Y5L4 | Mitochondrial import inner membrane translocase subunit Tim13 | EBI-11129266 | 0.35 |
| Q96T76 | MMS19 nucleotide excision repair protein homolog (hMMS19) (MET18 homolog) (MMS19-like protein) | EBI-11129266 | 0.35 |
| P11498 | Pyruvate carboxylase, mitochondrial (EC 6.4.1.1) (Pyruvic carboxylase) (PCB) | EBI-11129266 | 0.35 |
| Q96QC0 | Serine/threonine-protein phosphatase 1 regulatory subunit 10 (MHC class I region proline-rich protein CAT53) (PP1-binding protein of 114 kDa) (Phosphatase 1 nuclear targeting subunit) (Protein FB19) (p99) | EBI-11129266 | 0.35 |
| Q96ED9 | Protein Hook homolog 2 (h-hook2) (hHK2) | EBI-11129266 | 0.35 |
| Q8WUA2 | Peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) (EC 5.2.1.8) (Cyclophilin-like protein PPIL4) (Rotamase PPIL4) | EBI-11129266 | 0.35 |
| Q9H0G5 | Nuclear speckle splicing regulatory protein 1 (Coiled-coil domain-containing protein 55) (Nuclear speckle-related protein 70) (NSrp70) | EBI-11129266 | 0.35 |
| P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-11129266 | 0.35 |
| Q9Y2D8 | Afadin- and alpha-actinin-binding protein (ADIP) (Afadin DIL domain-interacting protein) (SSX2-interacting protein) | EBI-11129266 | 0.35 |
| Q92616 | eIF-2-alpha kinase activator GCN1 (GCN1 eIF-2-alpha kinase activator homolog) (GCN1-like protein 1) (General control of amino-acid synthesis 1-like protein 1) (Translational activator GCN1) (HsGCN1) | EBI-11129266 | 0.35 |
| Q5T4S7 | E3 ubiquitin-protein ligase UBR4 (EC 2.3.2.27) (600 kDa retinoblastoma protein-associated factor) (N-recognin-4) (RING-type E3 ubiquitin transferase UBR4) (Retinoblastoma-associated factor of 600 kDa) (RBAF600) (p600) (Zinc finger UBR1-type protein 1) | EBI-11129266 | 0.35 |
| O14828 | Secretory carrier-associated membrane protein 3 (Secretory carrier membrane protein 3) | EBI-11129266 | 0.35 |
| P50750 | Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C-2K) (Cell division cycle 2-like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine-protein kinase PITALRE) (Tat-associated kinase complex catalytic subunit) | EBI-11129266 | 0.35 |
| Q9Y285 | Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (CML33) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) | EBI-11129266 | 0.35 |
| P50990 | T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15) | EBI-11129266 | 0.35 |
| P42695 | Condensin-2 complex subunit D3 (Non-SMC condensin II complex subunit D3) (hCAP-D3) | EBI-11129266 | 0.35 |
| P31948 | Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521) | EBI-11129266 | 0.35 |
| O75937 | DnaJ homolog subfamily C member 8 (Splicing protein spf31) | EBI-11129266 | 0.35 |
| Q03518 | Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4) | EBI-11129266 | 0.35 |
| P25705 | ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha) | EBI-11129266 | 0.35 |
| P55265 | Double-stranded RNA-specific adenosine deaminase (DRADA) (EC 3.5.4.37) (136 kDa double-stranded RNA-binding protein) (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP) | EBI-11129266 | 0.35 |
| Q9Y6N5 | Sulfide:quinone oxidoreductase, mitochondrial (SQOR) (EC 1.8.5.8) (Sulfide dehydrogenase-like) (Sulfide quinone oxidoreductase) | EBI-11129266 | 0.35 |
| Q96I25 | Splicing factor 45 (45 kDa-splicing factor) (RNA-binding motif protein 17) | EBI-11129266 | 0.35 |
| P52756 | RNA-binding protein 5 (Protein G15) (Putative tumor suppressor LUCA15) (RNA-binding motif protein 5) (Renal carcinoma antigen NY-REN-9) | EBI-11129266 | 0.35 |
| O60313 | Dynamin-like 120 kDa protein, mitochondrial (EC 3.6.5.5) (Optic atrophy protein 1) [Cleaved into: Dynamin-like 120 kDa protein, form S1] | EBI-11129266 | 0.35 |
| Q13451 | Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKBP-5) (FKBP54) (p54) (HSP90-binding immunophilin) (Rotamase) | EBI-11129266 | 0.35 |
| P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-11129266 | 0.35 |
| Q96E88 | NCOA4 protein | EBI-11129266 | 0.35 |
| Q7Z4V5 | Hepatoma-derived growth factor-related protein 2 (HDGF-related protein 2) (HRP-2) (Hepatoma-derived growth factor 2) (HDGF-2) | EBI-11129266 | 0.35 |
| P40227 | T-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20) | EBI-11129266 | 0.35 |
| P53621 | Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (HEP-COP) (HEPCOP) [Cleaved into: Xenin (Xenopsin-related peptide); Proxenin] | EBI-11129266 | 0.35 |
| O75616 | GTPase Era, mitochondrial (H-ERA) (hERA) (Conserved ERA-like GTPase) (CEGA) (ERA-W) (ERA-like protein 1) | EBI-11129266 | 0.35 |
| B4E1Q4 | Serine/threonine-protein kinase RIO3 (EC 2.7.11.1) | EBI-11129266 | 0.35 |
| P14625 | Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog) | EBI-11129266 | 0.35 |
| O75533 | Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155) | EBI-11129266 | 0.35 |
| P10809 | 60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein) | EBI-11129266 | 0.35 |
| Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
| Q9P296 | C5a anaphylatoxin chemotactic receptor 2 (Complement component 5a receptor 2) (G-protein coupled receptor 77) | EBI-21519943 | 0.35 |
| Q14627 | Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2) | EBI-21561326 | 0.35 |
| Q9UQV4 | Lysosome-associated membrane glycoprotein 3 (LAMP-3) (Lysosomal-associated membrane protein 3) (DC-lysosome-associated membrane glycoprotein) (DC LAMP) (Protein TSC403) (CD antigen CD208) | EBI-21563011 | 0.35 |
| Q8WWB7 | Glycosylated lysosomal membrane protein (Lysosomal protein NCU-G1) | EBI-21569743 | 0.35 |
| O14498 | Immunoglobulin superfamily containing leucine-rich repeat protein | EBI-21576861 | 0.35 |
| Q03405 | Urokinase plasminogen activator surface receptor (U-PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87) | EBI-21577545 | 0.35 |
| P13473 | Lysosome-associated membrane glycoprotein 2 (LAMP-2) (Lysosome-associated membrane protein 2) (CD107 antigen-like family member B) (LGP-96) (CD antigen CD107b) | EBI-21591420 | 0.35 |
| Q6ZSG2 | Inhibitory synaptic factor 2A (InSyn2) | EBI-21681971 | 0.35 |
| P20231 | Tryptase beta-2 (Tryptase-2) (EC 3.4.21.59) (Tryptase II) | EBI-21755901 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| Q15649 | Zinc finger HIT domain-containing protein 3 (HNF-4a coactivator) (Thyroid hormone receptor interactor 3) (Thyroid receptor-interacting protein 3) (TR-interacting protein 3) (TRIP-3) | EBI-26685717 | 0.37 |
Database | Links |
| UNIPROT | O43542 O43568 Q9BU18 |
| Pfam | PF08423 |
| PROSITE | PS50162 |
| OMIM | 114480 600675 613972 |
| DisGeNET | 7517 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory