DNA repair protein XRCC3 - Homo sapiens

DNA repair protein XRCC3 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	DNA repair protein XRCC3
Accession Code	O43542
Gene	XRCC3
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 346)
MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH GGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVT EAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH

Subcellular Location

Description
Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Mitochondrion. Note=Accumulates in discrete nuclear foci prior to DNA damage, and these foci persist throughout the time course of DNA repair.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Chromosome, Telomeric Region (GO:0000781) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Mitochondrion (GO:0005739) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Rad51C-XRCC3 Complex (GO:0033065) Replication Fork (GO:0005657)

Biology & Function

Description
Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the RAD51 paralog protein complex CX3 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, CX3 acts downstream of RAD51 recruitment; the complex binds predominantly to the intersection of the four duplex arms of the Holliday junction (HJ) and to junctions of replication forks. Involved in HJ resolution and thus in processing HR intermediates late in the DNA repair process; the function may be linked to the CX3 complex and seems to involve GEN1 during mitotic cell cycle progression. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C. {Experimental EvidencePubMed:14716019, Experimental EvidencePubMed:20413593, Experimental EvidencePubMed:23108668, Experimental EvidencePubMed:23149936}.
Assigned Ontology terms

Biological Process	Cellular Response To DNA Damage Stimulus (GO:0006974) DNA Recombination (GO:0006310) DNA Repair (GO:0006281) Double-Strand Break Repair Via Homologous Recombination (GO:0000724) Double-Strand Break Repair Via Synthesis-Dependent Strand Annealing (GO:0045003) Interstrand Cross-Link Repair (GO:0036297) Positive Regulation Of Mitotic Cell Cycle Spindle Assembly Checkpoint (GO:0090267) Regulation Of Centrosome Duplication (GO:0010824) Resolution Of Mitotic Recombination Intermediates (GO:0071140) Response To Organic Substance (GO:0010033) T-Circle Formation (GO:0090656) Telomere Maintenance Via Recombination (GO:0000722) Telomere Maintenance Via Telomere Trimming (GO:0090737) Telomeric Loop Disassembly (GO:0090657)
Molecular Function	ATP Binding (GO:0005524) ATP-Dependent DNA Damage Sensor Activity (GO:0140664) DNA Binding (GO:0003677)

Disease associations

Description
Breast cancer (BC) [MIM:114480]: A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. {Experimental EvidencePubMed:12023982}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. Melanoma, cutaneous malignant 6 (CMM6) [MIM:613972]: A malignant neoplasm of melanocytes, arising de novo or from a pre- existing benign nevus, which occurs most often in the skin but may also involve other sites. {Experimental EvidencePubMed:11059748}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry.
Database Associations
OMIM	114480 600675 613972
DisGeNET	7517

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (15 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q8IX12	Cell division cycle and apoptosis regulator protein 1	EBI-11129266	0.35
Q9Y6K0	Choline/ethanolaminephosphotransferase 1	EBI-11129266	0.35
Q8IWX8	Calcium homeostasis endoplasmic reticulum protein	EBI-11129266	0.35
Q07065	Cytoskeleton-associated protein 4	EBI-11129266	0.35
P31689	DnaJ homolog subfamily A member 1	EBI-11129266	0.35
Q96RT1	Erbin	EBI-11129266	0.35
Q8TAG9	Exocyst complex component 6	EBI-11129266	0.35
O00165	HCLS1-associated protein X-1	EBI-11129266	0.35
P42167	Thymopentin	EBI-11129266	0.35
Q9NZM1	Myoferlin	EBI-11129266	0.35
Q8N1F7	Nuclear pore complex protein Nup93	EBI-11129266	0.35
O43502	DNA repair protein RAD51 homolog 3	EBI-9119744	0.94
Q06609	DNA repair protein RAD51 homolog 1	EBI-9249126	0.73
Q8NFQ8	Torsin-1A-interacting protein 2	EBI-21508086	0.35
Q9H3U1	Protein unc-45 homolog A	EBI-11129266	0.35
Interactions with other proteins (134 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8ZAN0	Fatty acid oxidation complex subunit alpha [Includes: Enoyl-CoA hydratase/Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA epimerase (EC 4.2.1.17) (EC 5.1.2.3) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)]	EBI-2849986	0.00
A0A380PDY1	Oligogalacturonate lyase (EC 4.2.2.6)	EBI-2849973	0.00
Q6NVH7	ATPase SWSAP1 (SWIM-type zinc finger 7-associated protein 1) (SWS1-associated protein 1) (ZSWIM7-associated protein 1) (ZSWIM7AP1)	EBI-5282263	0.52
Q19AV6	Zinc finger SWIM domain-containing protein 7 (SWIM domain-containing and Srs2-interacting protein 1 homolog) (SWIM-type zinc finger domain-containing protein 7)	EBI-5282291	0.40
Q9H6U6	BCAS3 microtubule associated cell migration factor (Breast carcinoma-amplified sequence 3) (GAOB1)	EBI-9071268	0.37
P09341	Growth-regulated alpha protein (C-X-C motif chemokine 1) (GRO-alpha(1-73)) (Melanoma growth stimulatory activity) (MGSA) (Neutrophil-activating protein 3) (NAP-3) [Cleaved into: GRO-alpha(4-73); GRO-alpha(5-73); GRO-alpha(6-73)]	EBI-9071281	0.37
Q96KN1	Protein LRATD2 (Breast cancer membrane protein 101) (LRAT domain-containing 2) (Protein FAM84B) (Protein NSE2)	EBI-9071294	0.37
Q4ZG55	Protein GREB1 (Gene regulated in breast cancer 1 protein)	EBI-9071307	0.37
Q86UX2	Inter-alpha-trypsin inhibitor heavy chain H5 (ITI heavy chain H5) (ITI-HC5) (Inter-alpha-inhibitor heavy chain 5)	EBI-9071320	0.37
Q9UBG0	C-type mannose receptor 2 (C-type lectin domain family 13 member E) (Endocytic receptor 180) (Macrophage mannose receptor 2) (Urokinase-type plasminogen activator receptor-associated protein) (UPAR-associated protein) (Urokinase receptor-associated protein) (CD antigen CD280)	EBI-9071333	0.37
Q9UJX0	Oxidative stress-induced growth inhibitor 1 (Bone marrow stromal cell-derived growth inhibitor) (BMSC-derived growth inhibitor) (Ovary, kidney and liver protein 38) (huOKL38) (Pregnancy-induced growth inhibitor OKL38)	EBI-9071346	0.37
Q9P2W1	Homologous-pairing protein 2 homolog (Nuclear receptor coactivator GT198) (PSMC3-interacting protein) (Proteasome 26S ATPase subunit 3-interacting protein) (Tat-binding protein 1-interacting protein) (TBP-1-interacting protein)	EBI-9071359	0.37
Q92560	Ubiquitin carboxyl-terminal hydrolase BAP1 (EC 3.4.19.12) (BRCA1-associated protein 1) (Cerebral protein 6)	EBI-9071372	0.37
Q5VTR2	E3 ubiquitin-protein ligase BRE1A (BRE1-A) (hBRE1) (EC 2.3.2.27) (RING finger protein 20) (RING-type E3 ubiquitin transferase BRE1A)	EBI-9071385	0.37
Q96QR1	Secretoglobin family 3A member 1 (Cytokine HIN-1) (High in normal 1) (Pneumo secretory protein 2) (PnSP-2) (Uteroglobin-related protein 2)	EBI-9071398	0.37
P36952	Serpin B5 (Maspin) (Peptidase inhibitor 5) (PI-5)	EBI-9071411	0.37
O95863	Zinc finger protein SNAI1 (Protein snail homolog 1) (Protein sna)	EBI-9071424	0.37
P04155	Trefoil factor 1 (Breast cancer estrogen-inducible protein) (PNR-2) (Polypeptide P1.A) (hP1.A) (Protein pS2)	EBI-9071437	0.37
Q14258	E3 ubiquitin/ISG15 ligase TRIM25 (EC 6.3.2.n3) (Estrogen-responsive finger protein) (RING finger protein 147) (RING-type E3 ubiquitin transferase) (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM25) (Tripartite motif-containing protein 25) (Ubiquitin/ISG15-conjugating enzyme TRIM25) (Zinc finger protein 147)	EBI-9071451	0.37
Q86YC2	Partner and localizer of BRCA2	EBI-9119744	0.58
P51587	Breast cancer type 2 susceptibility protein (Fanconi anemia group D1 protein)	EBI-9119744	0.53
O43264	Centromere/kinetochore protein zw10 homolog	EBI-11129266	0.35
Q9C0C2	182 kDa tankyrase-1-binding protein	EBI-11129266	0.35
Q9BVQ7	Ribosome biogenesis protein SPATA5L1 (EC 3.6.4.10) (Spermatogenesis-associated protein 5-like protein 1)	EBI-11129266	0.35
P49368	T-complex protein 1 subunit gamma (TCP-1-gamma) (CCT-gamma) (hTRiC5)	EBI-11129266	0.35
O14579	Coatomer subunit epsilon (Epsilon-coat protein) (Epsilon-COP)	EBI-11129266	0.35
P12268	Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (Inosine-5'-monophosphate dehydrogenase type II) (IMP dehydrogenase II) (IMPDH-II)	EBI-11129266	0.35
Q9HDC5	Junctophilin-1 (JP-1) (Junctophilin type 1)	EBI-11129266	0.35
Q9BWM7	Sideroflexin-3	EBI-11129266	0.35
Q8N302	Angiogenic factor with G patch and FHA domains 1 (Angiogenic factor VG5Q) (hVG5Q) (G patch domain-containing protein 7) (Vasculogenesis gene on 5q protein)	EBI-11129266	0.35
Q13435	Splicing factor 3B subunit 2 (Pre-mRNA-splicing factor SF3b 145 kDa subunit) (SF3b145) (Spliceosome-associated protein 145) (SAP 145)	EBI-11129266	0.35
Q96P70	Importin-9 (Imp9) (Ran-binding protein 9) (RanBP9)	EBI-11129266	0.35
Q9H840	Gem-associated protein 7 (Gemin-7) (SIP3)	EBI-11129266	0.35
Q8WVB6	Chromosome transmission fidelity protein 18 homolog (hCTF18) (CHL12)	EBI-11129266	0.35
Q86UP2	Kinectin (CG-1 antigen) (Kinesin receptor)	EBI-11129266	0.35
P16615	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase)	EBI-11129266	0.35
O60220	Mitochondrial import inner membrane translocase subunit Tim8 A (Deafness dystonia protein 1) (X-linked deafness dystonia protein)	EBI-11129266	0.35
Q15293	Reticulocalbin-1	EBI-11129266	0.35
Q9NVC6	Mediator of RNA polymerase II transcription subunit 17 (Activator-recruited cofactor 77 kDa component) (ARC77) (Cofactor required for Sp1 transcriptional activation subunit 6) (CRSP complex subunit 6) (Mediator complex subunit 17) (Thyroid hormone receptor-associated protein complex 80 kDa component) (Trap80) (Transcriptional coactivator CRSP77) (Vitamin D3 receptor-interacting protein complex 80 kDa component) (DRIP80)	EBI-11129266	0.35
F8W038	Chromosome 17 open reading frame 49	EBI-11129266	0.35
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-11129266	0.35
P17987	T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha)	EBI-11129266	0.35
O94822	E3 ubiquitin-protein ligase listerin (EC 2.3.2.27) (RING finger protein 160) (RING-type E3 ubiquitin transferase listerin) (Zinc finger protein 294)	EBI-11129266	0.35
Q96CT7	Coiled-coil domain-containing protein 124	EBI-11129266	0.35
Q9NZ01	Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER)	EBI-11129266	0.35
Q9H9B4	Sideroflexin-1	EBI-11129266	0.35
P47897	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	EBI-11129266	0.35
Q99570	Phosphoinositide 3-kinase regulatory subunit 4 (PI3-kinase regulatory subunit 4) (EC 2.7.11.1) (PI3-kinase p150 subunit) (Phosphoinositide 3-kinase adaptor protein)	EBI-11129266	0.35
B4E1G1	Derlin	EBI-11129266	0.35
P98175	RNA-binding protein 10 (G patch domain-containing protein 9) (RNA-binding motif protein 10) (RNA-binding protein S1-1) (S1-1)	EBI-11129266	0.35
F8W7C6	60S ribosomal protein L10	EBI-11129266	0.35
Q96BD0	Solute carrier organic anion transporter family member 4A1 (OATP4A1) (Colon organic anion transporter) (Organic anion transporter polypeptide-related protein 1) (OATP-RP1) (OATPRP1) (POAT) (Organic anion-transporting polypeptide E) (OATP-E) (Sodium-independent organic anion transporter E) (Solute carrier family 21 member 12)	EBI-11129266	0.35
P31327	Carbamoyl-phosphate synthase [ammonia], mitochondrial (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I)	EBI-11129266	0.35
O75152	Zinc finger CCCH domain-containing protein 11A	EBI-11129266	0.35
P20839	Inosine-5'-monophosphate dehydrogenase 1 (IMP dehydrogenase 1) (IMPD 1) (IMPDH 1) (EC 1.1.1.205) (IMPDH-I)	EBI-11129266	0.35
O60524	Ribosome quality control complex subunit NEMF (Antigen NY-CO-1) (Nuclear export mediator factor) (Serologically defined colon cancer antigen 1)	EBI-11129266	0.35
P22626	Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP A2/B1)	EBI-11129266	0.35
Q9Y2X0	Mediator of RNA polymerase II transcription subunit 16 (Mediator complex subunit 16) (Thyroid hormone receptor-associated protein 5) (Thyroid hormone receptor-associated protein complex 95 kDa component) (Trap95) (Vitamin D3 receptor-interacting protein complex 92 kDa component) (DRIP92)	EBI-11129266	0.35
Q86UK7	E3 ubiquitin-protein ligase ZNF598 (EC 2.3.2.27) (Zinc finger protein 598)	EBI-11129266	0.35
O95071	E3 ubiquitin-protein ligase UBR5 (EC 2.3.2.26) (E3 ubiquitin-protein ligase, HECT domain-containing 1) (HECT-type E3 ubiquitin transferase UBR5) (Hyperplastic discs protein homolog) (hHYD) (Progestin-induced protein)	EBI-11129266	0.35
Q14152	Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185)	EBI-11129266	0.35
O00303	Eukaryotic translation initiation factor 3 subunit F (eIF3f) (Deubiquitinating enzyme eIF3f) (EC 3.4.19.12) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47)	EBI-11129266	0.35
O60841	Eukaryotic translation initiation factor 5B (eIF-5B) (EC 3.6.5.3) (Translation initiation factor IF-2)	EBI-11129266	0.35
Q99707	Methionine synthase (MS) (EC 2.1.1.13) (5-methyltetrahydrofolate--homocysteine methyltransferase) (Cobalamin-dependent methionine synthase) (Vitamin-B12 dependent methionine synthase)	EBI-11129266	0.35
P54278	Mismatch repair endonuclease PMS2 (EC 3.1.-.-) (DNA mismatch repair protein PMS2) (PMS1 protein homolog 2)	EBI-11129266	0.35
Q15758	Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)	EBI-11129266	0.35
Q92973	Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP)	EBI-11129266	0.35
O14949	Cytochrome b-c1 complex subunit 8 (Complex III subunit 8) (Complex III subunit VIII) (Ubiquinol-cytochrome c reductase complex 9.5 kDa protein) (Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C)	EBI-11129266	0.35
Q96D15	Reticulocalbin-3 (EF-hand calcium-binding protein RLP49)	EBI-11129266	0.35
Q9NS69	Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)	EBI-11129266	0.53
P51798	H(+)/Cl(-) exchange transporter 7 (Chloride channel 7 alpha subunit) (Chloride channel protein 7) (ClC-7)	EBI-11129266	0.35
O75477	Erlin-1 (Endoplasmic reticulum lipid raft-associated protein 1) (Protein KE04) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (SPFH domain-containing protein 1)	EBI-11129266	0.35
Q14318	Peptidyl-prolyl cis-trans isomerase FKBP8 (PPIase FKBP8) (EC 5.2.1.8) (38 kDa FK506-binding protein) (38 kDa FKBP) (FKBP-38) (hFKBP38) (FK506-binding protein 8) (FKBP-8) (FKBPR38) (Rotamase)	EBI-11129266	0.35
O43852	Calumenin (Crocalbin) (IEF SSP 9302)	EBI-11129266	0.35
Q9UI10	Translation initiation factor eIF-2B subunit delta (eIF-2B GDP-GTP exchange factor subunit delta)	EBI-11129266	0.35
P06746	DNA polymerase beta (EC 2.7.7.7) (EC 4.2.99.-)	EBI-11129266	0.35
Q9HCN4	GPN-loop GTPase 1 (EC 3.6.5.-) (MBD2-interacting protein) (MBDin) (RNAPII-associated protein 4) (XPA-binding protein 1)	EBI-11129266	0.35
Q15459	Splicing factor 3A subunit 1 (SF3a120) (Spliceosome-associated protein 114) (SAP 114)	EBI-11129266	0.35
Q8WW12	PEST proteolytic signal-containing nuclear protein (PCNP) (PEST-containing nuclear protein)	EBI-11129266	0.35
O75448	Mediator of RNA polymerase II transcription subunit 24 (Activator-recruited cofactor 100 kDa component) (ARC100) (Cofactor required for Sp1 transcriptional activation subunit 4) (CRSP complex subunit 4) (Mediator complex subunit 24) (Thyroid hormone receptor-associated protein 4) (Thyroid hormone receptor-associated protein complex 100 kDa component) (Trap100) (hTRAP100) (Vitamin D3 receptor-interacting protein complex 100 kDa component) (DRIP100)	EBI-11129266	0.35
Q99942	E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (RING finger protein 5) (Ram1 homolog) (HsRma1)	EBI-11129266	0.35
Q969V3	Nicalin (Nicastrin-like protein)	EBI-11129266	0.35
Q9UJS0	Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial (Calcium-binding mitochondrial carrier protein Aralar2) (ARALAR-related gene 2) (ARALAR2) (Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13)	EBI-11129266	0.35
Q99623	Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity)	EBI-11129266	0.35
C9JA28	Translocon-associated protein subunit gamma (Signal sequence receptor subunit gamma)	EBI-11129266	0.35
Q9H3F6	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 (hBACURD3) (BTB/POZ domain-containing protein KCTD10) (Potassium channel tetramerization domain-containing protein 10)	EBI-11129266	0.35
Q9Y5L4	Mitochondrial import inner membrane translocase subunit Tim13	EBI-11129266	0.35
Q96T76	MMS19 nucleotide excision repair protein homolog (hMMS19) (MET18 homolog) (MMS19-like protein)	EBI-11129266	0.35
P11498	Pyruvate carboxylase, mitochondrial (EC 6.4.1.1) (Pyruvic carboxylase) (PCB)	EBI-11129266	0.35
Q96QC0	Serine/threonine-protein phosphatase 1 regulatory subunit 10 (MHC class I region proline-rich protein CAT53) (PP1-binding protein of 114 kDa) (Phosphatase 1 nuclear targeting subunit) (Protein FB19) (p99)	EBI-11129266	0.35
Q96ED9	Protein Hook homolog 2 (h-hook2) (hHK2)	EBI-11129266	0.35
Q8WUA2	Peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) (EC 5.2.1.8) (Cyclophilin-like protein PPIL4) (Rotamase PPIL4)	EBI-11129266	0.35
Q9H0G5	Nuclear speckle splicing regulatory protein 1 (Coiled-coil domain-containing protein 55) (Nuclear speckle-related protein 70) (NSrp70)	EBI-11129266	0.35
P08238	Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84)	EBI-11129266	0.35
Q9Y2D8	Afadin- and alpha-actinin-binding protein (ADIP) (Afadin DIL domain-interacting protein) (SSX2-interacting protein)	EBI-11129266	0.35
Q92616	eIF-2-alpha kinase activator GCN1 (GCN1 eIF-2-alpha kinase activator homolog) (GCN1-like protein 1) (General control of amino-acid synthesis 1-like protein 1) (Translational activator GCN1) (HsGCN1)	EBI-11129266	0.35
Q5T4S7	E3 ubiquitin-protein ligase UBR4 (EC 2.3.2.27) (600 kDa retinoblastoma protein-associated factor) (N-recognin-4) (RING-type E3 ubiquitin transferase UBR4) (Retinoblastoma-associated factor of 600 kDa) (RBAF600) (p600) (Zinc finger UBR1-type protein 1)	EBI-11129266	0.35
O14828	Secretory carrier-associated membrane protein 3 (Secretory carrier membrane protein 3)	EBI-11129266	0.35
P50750	Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C-2K) (Cell division cycle 2-like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine-protein kinase PITALRE) (Tat-associated kinase complex catalytic subunit)	EBI-11129266	0.35
Q9Y285	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (CML33) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	EBI-11129266	0.35
P50990	T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15)	EBI-11129266	0.35
P42695	Condensin-2 complex subunit D3 (Non-SMC condensin II complex subunit D3) (hCAP-D3)	EBI-11129266	0.35
P31948	Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521)	EBI-11129266	0.35
O75937	DnaJ homolog subfamily C member 8 (Splicing protein spf31)	EBI-11129266	0.35
Q03518	Antigen peptide transporter 1 (APT1) (EC 7.4.2.-) (ATP-binding cassette sub-family B member 2) (Peptide supply factor 1) (Peptide transporter PSF1) (PSF-1) (Peptide transporter TAP1) (Peptide transporter involved in antigen processing 1) (Really interesting new gene 4 protein) (RING4)	EBI-11129266	0.35
P25705	ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha)	EBI-11129266	0.35
P55265	Double-stranded RNA-specific adenosine deaminase (DRADA) (EC 3.5.4.37) (136 kDa double-stranded RNA-binding protein) (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP)	EBI-11129266	0.35
Q9Y6N5	Sulfide:quinone oxidoreductase, mitochondrial (SQOR) (EC 1.8.5.8) (Sulfide dehydrogenase-like) (Sulfide quinone oxidoreductase)	EBI-11129266	0.35
Q96I25	Splicing factor 45 (45 kDa-splicing factor) (RNA-binding motif protein 17)	EBI-11129266	0.35
P52756	RNA-binding protein 5 (Protein G15) (Putative tumor suppressor LUCA15) (RNA-binding motif protein 5) (Renal carcinoma antigen NY-REN-9)	EBI-11129266	0.35
O60313	Dynamin-like 120 kDa protein, mitochondrial (EC 3.6.5.5) (Optic atrophy protein 1) [Cleaved into: Dynamin-like 120 kDa protein, form S1]	EBI-11129266	0.35
Q13451	Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKBP-5) (FKBP54) (p54) (HSP90-binding immunophilin) (Rotamase)	EBI-11129266	0.35
P08621	U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70)	EBI-11129266	0.35
Q96E88	NCOA4 protein	EBI-11129266	0.35
Q7Z4V5	Hepatoma-derived growth factor-related protein 2 (HDGF-related protein 2) (HRP-2) (Hepatoma-derived growth factor 2) (HDGF-2)	EBI-11129266	0.35
P40227	T-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20)	EBI-11129266	0.35
P53621	Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (HEP-COP) (HEPCOP) [Cleaved into: Xenin (Xenopsin-related peptide); Proxenin]	EBI-11129266	0.35
O75616	GTPase Era, mitochondrial (H-ERA) (hERA) (Conserved ERA-like GTPase) (CEGA) (ERA-W) (ERA-like protein 1)	EBI-11129266	0.35
B4E1Q4	Serine/threonine-protein kinase RIO3 (EC 2.7.11.1)	EBI-11129266	0.35
P14625	Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog)	EBI-11129266	0.35
O75533	Splicing factor 3B subunit 1 (Pre-mRNA-splicing factor SF3b 155 kDa subunit) (SF3b155) (Spliceosome-associated protein 155) (SAP 155)	EBI-11129266	0.35
P10809	60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein)	EBI-11129266	0.35
Q6P5F9	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-11603310	0.35
Q9P296	C5a anaphylatoxin chemotactic receptor 2 (Complement component 5a receptor 2) (G-protein coupled receptor 77)	EBI-21519943	0.35
Q14627	Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2)	EBI-21561326	0.35
Q9UQV4	Lysosome-associated membrane glycoprotein 3 (LAMP-3) (Lysosomal-associated membrane protein 3) (DC-lysosome-associated membrane glycoprotein) (DC LAMP) (Protein TSC403) (CD antigen CD208)	EBI-21563011	0.35
Q8WWB7	Glycosylated lysosomal membrane protein (Lysosomal protein NCU-G1)	EBI-21569743	0.35
O14498	Immunoglobulin superfamily containing leucine-rich repeat protein	EBI-21576861	0.35
Q03405	Urokinase plasminogen activator surface receptor (U-PAR) (uPAR) (Monocyte activation antigen Mo3) (CD antigen CD87)	EBI-21577545	0.35
P13473	Lysosome-associated membrane glycoprotein 2 (LAMP-2) (Lysosome-associated membrane protein 2) (CD107 antigen-like family member B) (LGP-96) (CD antigen CD107b)	EBI-21591420	0.35
Q6ZSG2	Inhibitory synaptic factor 2A (InSyn2)	EBI-21681971	0.35
P20231	Tryptase beta-2 (Tryptase-2) (EC 3.4.21.59) (Tryptase II)	EBI-21755901	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
Q15649	Zinc finger HIT domain-containing protein 3 (HNF-4a coactivator) (Thyroid hormone receptor interactor 3) (Thyroid receptor-interacting protein 3) (TR-interacting protein 3) (TRIP-3)	EBI-26685717	0.37

Cross-References

Database	Links
UNIPROT	O43542 O43568 Q9BU18
Pfam	PF08423
PROSITE	PS50162
OMIM	114480 600675 613972
DisGeNET	7517

DNA repair protein XRCC3 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (15 interactors)

Interactions with other proteins (134 interactors)

Cross-References

Database

Links

Description

Description