Lysophospholipase D GDPD1 - Homo sapiens

Lysophospholipase D GDPD1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Lysophospholipase D GDPD1
Accession Code	Q8N9F7
Gene	GDPD1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 314)
MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSFQRACQCEGKD NRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLM RKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFLHNFSA

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:18991142}. Membrane {Curator Inference}; Multi-pass membrane protein {Sequence Analysis}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:18991142}. Endoplasmic reticulum {ECO:0000269\|PubMed:27637550}. Note=Concentrated at the perinuclear region and the cell periphery (PubMed:18991142). {Experimental EvidencePubMed:18991142}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum Membrane (GO:0005789) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Hydrolyzes lysoglycerophospholipids to produce lysophosphatidic acid (LPA) and the corresponding amines (PubMed:27637550, PubMed:25596343). Shows a preference for 1-O-alkyl- sn-glycero-3-phosphocholine (lyso-PAF), lysophosphatidylethanolamine (lyso-PE) and lysophosphatidylcholine (lyso-PC) (PubMed:27637550, PubMed:25596343). May be involved in bioactive N-acylethanolamine biosynthesis from both N-acyl-lysoplasmenylethanolamin (N-acyl- lysoPlsEt) and N-acyl-lysophosphatidylethanolamin (N-acyl-lysoPE) (PubMed:27637550, PubMed:25596343). In addition, hydrolyzes glycerophospho-N-acylethanolamine to N-acylethanolamine (PubMed:27637550). Does not display glycerophosphodiester phosphodiesterase activity, since it cannot hydrolyze either glycerophosphoinositol or glycerophosphocholine (By similarity). {By SimilarityUniProtKB:Q9CRY7, Experimental EvidencePubMed:25596343, Experimental EvidencePubMed:27637550}.
Assigned Ontology terms

Biological Process	Glycerophospholipid Catabolic Process (GO:0046475) N-Acylethanolamine Metabolic Process (GO:0070291)
Molecular Function	Lysophospholipase Activity (GO:0004622) Metal Ion Binding (GO:0046872) Phosphoric Diester Hydrolase Activity (GO:0008081)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
K9N7C7	2'-O-methyltransferase	EBI-26374966	0.35
Interactions with other proteins (28 interactors)

Partner (UniProt)		IntAct	Confidence score
P0DOE9	Non-structural protein 1 (NS1) (Non-structural protein 1C)	EBI-6138583	0.35
P62079	Tetraspanin-5 (Tspan-5) (Tetraspan NET-4) (Transmembrane 4 superfamily member 9)	EBI-21619035	0.35
P69905	Hemoglobin subunit alpha (Alpha-globin) (Hemoglobin alpha chain) [Cleaved into: Hemopressin]	EBI-21822769	0.35
P68871	Hemoglobin subunit beta (Beta-globin) (Hemoglobin beta chain) [Cleaved into: LVV-hemorphin-7; Spinorphin]	EBI-21822769	0.35
P19823	Inter-alpha-trypsin inhibitor heavy chain H2 (ITI heavy chain H2) (ITI-HC2) (Inter-alpha-inhibitor heavy chain 2) (Inter-alpha-trypsin inhibitor complex component II) (Serum-derived hyaluronan-associated protein) (SHAP)	EBI-21822769	0.35
P19652	Alpha-1-acid glycoprotein 2 (AGP 2) (Orosomucoid-2) (OMD 2)	EBI-21822769	0.35
P0C0L4	Complement C4-A (Acidic complement C4) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2) [Cleaved into: Complement C4 beta chain; Complement C4-A alpha chain; C4a anaphylatoxin; C4b-A; C4d-A; Complement C4 gamma chain]	EBI-21822769	0.35
P06727	Apolipoprotein A-IV (Apo-AIV) (ApoA-IV) (Apolipoprotein A4)	EBI-21822769	0.35
P04217	Alpha-1B-glycoprotein (Alpha-1-B glycoprotein)	EBI-21822769	0.35
P02790	Hemopexin (Beta-1B-glycoprotein)	EBI-21822769	0.35
P02787	Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin)	EBI-21822769	0.35
P02768	Albumin	EBI-21822769	0.35
P02765	Alpha-2-HS-glycoprotein (Alpha-2-Z-globulin) (Ba-alpha-2-glycoprotein) (Fetuin-A) [Cleaved into: Alpha-2-HS-glycoprotein chain A; Alpha-2-HS-glycoprotein chain B]	EBI-21822769	0.35
P02763	Alpha-1-acid glycoprotein 1 (AGP 1) (Orosomucoid-1) (OMD 1)	EBI-21822769	0.35
P02652	Apolipoprotein A-II (Apo-AII) (ApoA-II) (Apolipoprotein A2) [Cleaved into: Proapolipoprotein A-II (ProapoA-II); Truncated apolipoprotein A-II (Apolipoprotein A-II(1-76))]	EBI-21822769	0.35
P02647	Apolipoprotein A-I (Apo-AI) (ApoA-I) (Apolipoprotein A1) [Cleaved into: Proapolipoprotein A-I (ProapoA-I); Truncated apolipoprotein A-I (Apolipoprotein A-I(1-242))]	EBI-21822769	0.35
P02042	Hemoglobin subunit delta (Delta-globin) (Hemoglobin delta chain)	EBI-21822769	0.35
P01876	Immunoglobulin heavy constant alpha 1 (Ig alpha-1 chain C region) (Ig alpha-1 chain C region BUR) (Ig alpha-1 chain C region TRO)	EBI-21822769	0.35
P01859	Immunoglobulin heavy constant gamma 2 (Ig gamma-2 chain C region) (Ig gamma-2 chain C region DOT) (Ig gamma-2 chain C region TIL) (Ig gamma-2 chain C region ZIE)	EBI-21822769	0.35
P01857	Immunoglobulin heavy constant gamma 1 (Ig gamma-1 chain C region) (Ig gamma-1 chain C region EU) (Ig gamma-1 chain C region KOL) (Ig gamma-1 chain C region NIE)	EBI-21822769	0.35
P01042	Kininogen-1 (Alpha-2-thiol proteinase inhibitor) (Fitzgerald factor) (High molecular weight kininogen) (HMWK) (Williams-Fitzgerald-Flaujeac factor) [Cleaved into: Kininogen-1 heavy chain; T-kinin (Ile-Ser-Bradykinin); Bradykinin (Kallidin I); Lysyl-bradykinin (Kallidin II); Kininogen-1 light chain; Low molecular weight growth-promoting factor]	EBI-21822769	0.35
P01024	Complement C3 (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1) [Cleaved into: Complement C3 beta chain; C3-beta-c (C3bc); Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein (ASP) (C3adesArg); Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2]	EBI-21822769	0.35
P01023	Alpha-2-macroglobulin (Alpha-2-M) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5)	EBI-21822769	0.35
P01011	Alpha-1-antichymotrypsin (ACT) (Cell growth-inhibiting gene 24/25 protein) (Serpin A3) [Cleaved into: Alpha-1-antichymotrypsin His-Pro-less]	EBI-21822769	0.35
P01009	Alpha-1-antitrypsin (Alpha-1 protease inhibitor) (Alpha-1-antiproteinase) (Serpin A1) [Cleaved into: Short peptide from AAT (SPAAT)]	EBI-21822769	0.35
P00751	Complement factor B (EC 3.4.21.47) (C3/C5 convertase) (Glycine-rich beta glycoprotein) (GBG) (PBF2) (Properdin factor B) [Cleaved into: Complement factor B Ba fragment; Complement factor B Bb fragment]	EBI-21822769	0.35
P00738	Haptoglobin (Zonulin) [Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain]	EBI-21822769	0.35
P00450	Ceruloplasmin (EC 1.16.3.1) (Ferroxidase)	EBI-21822769	0.35

Cross-References

Database	Links
UNIPROT	Q8N9F7 A8W735 Q56VR1 Q8N4E3
Pfam	PF03009
PROSITE	PS51704
OMIM	616317

Lysophospholipase D GDPD1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (28 interactors)

Cross-References

Database

Links

Description

Description