Torsin-1A-interacting protein 1 - Mus musculus

Torsin-1A-interacting protein 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Torsin-1A-interacting protein 1
Accession Code	Q921T2
Gene	Tor1aip1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 595)
MAGERWQAEGPGEGWAIYVTPRAPIREGRRRLDPRNGDSSDAPAYGAHPSRRGRREVRFSEEPAEVYGDFEPRAAKERSPGGRRTPPEKFRPASAGEEVRESAYNLRSRPRRQRRAQEAEEMKTRRSARL EQHSQQPQLSPATSGRGLRDSPSSSEDREEDEPSSRPVTSQTASKKTLRTPEASVMNEDPISNLCRPPLRSPRLDSTYQTNGNTKTNEREATIVQQVNFFEEGETEDDLESSYSDITIRARSSDSLESRD EATPAAGNHPDSLRGLPHNQDFPAHENQPLLLTSGCQENPQEWVDRAVRMRSRMAYNNIQKSNFGNQSPSTSRPQSAIHHPNEPSVKIKWWLLGLVAILAVGLFWFFHTPAVETTAVQEFQNQMKQLQSK YQSQNEKLWKRGTTFLEKHLNSSLPRPQPAILLLTAAQDAAEVLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLVKHEVDQELTDGFKNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVAL VLTVLLEEKTLEASLGLKEIEEKVRDFLKVKFTSSSTASSYNHMDPDKLNGLWSRISHLVLPVQPENTLKAGSCL

Subcellular Location

Description
Nucleus inner membrane {By Similarity}; Single-pass membrane protein {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Inner Membrane	SL-0179	The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Membrane (GO:0016020) Nuclear Envelope (GO:0005635) Nuclear Inner Membrane (GO:0005637) Nuclear Membrane (GO:0031965) Nucleus (GO:0005634)

Biology & Function

Description
Required for nuclear membrane integrity. Induces TOR1A and TOR1B ATPase activity and is required for their location on the nuclear membrane. Binds to A- and B-type lamins. Possible role in membrane attachment and assembly of the nuclear lamina. {Experimental EvidencePubMed:20457914}.
Assigned Ontology terms

Biological Process	Membrane Organization (GO:0061024) Nuclear Membrane Organization (GO:0071763) Positive Regulation Of ATP-Dependent Activity (GO:0032781) Protein Localization To Nuclear Envelope (GO:0090435)
Molecular Function	ATPase Activator Activity (GO:0001671) ATPase Binding (GO:0051117) Cytoskeletal Protein Binding (GO:0008092) Lamin Binding (GO:0005521)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q99ME6	Protein ATP1B4	EBI-15644413	0.37
Q9Y6K0	Choline/ethanolaminephosphotransferase 1	EBI-10996616	0.35
Q7L576	Cytoplasmic FMR1-interacting protein 1	EBI-10996616	0.35
Q5JTV8	Torsin-1A-interacting protein 1	EBI-2559664	0.40
Interactions with other proteins (31 interactors)

Partner (UniProt)		IntAct	Confidence score
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-2559664	0.56
Q8TCX1	Cytoplasmic dynein 2 light intermediate chain 1 (Dynein 2 light intermediate chain)	EBI-10996616	0.35
D6RA89	Peroxisome biogenesis factor 10	EBI-10996616	0.35
P50416	Carnitine O-palmitoyltransferase 1, liver isoform (CPT1-L) (EC 2.3.1.21) (Carnitine O-palmitoyltransferase I, liver isoform) (CPT I) (CPTI-L) (Carnitine palmitoyltransferase 1A)	EBI-10996616	0.35
Q9UBD5	Origin recognition complex subunit 3 (Origin recognition complex subunit Latheo)	EBI-10996616	0.35
I3L1P8	Mitochondrial 2-oxoglutarate/malate carrier protein	EBI-10996616	0.35
Q13867	Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40)	EBI-10996616	0.35
O60292	Signal-induced proliferation-associated 1-like protein 3 (SIPA1-like protein 3) (SPA-1-like protein 3)	EBI-10996616	0.35
P52789	Hexokinase-2 (EC 2.7.1.1) (Hexokinase type II) (HK II) (Hexokinase-B) (Muscle form hexokinase)	EBI-10996616	0.35
Q5K651	Sterile alpha motif domain-containing protein 9 (SAM domain-containing protein 9)	EBI-10996616	0.35
Q15758	Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)	EBI-10996616	0.35
P0C0L5	Complement C4-B (Basic complement C4) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3) [Cleaved into: Complement C4 beta chain; Complement C4-B alpha chain; C4a anaphylatoxin; C4b-B; C4d-B; Complement C4 gamma chain]	EBI-10996616	0.35
Q9Y2H6	Fibronectin type-III domain-containing protein 3A (Human gene expressed in odontoblasts)	EBI-10996616	0.35
O00461	Golgi integral membrane protein 4 (Golgi integral membrane protein, cis) (GIMPc) (Golgi phosphoprotein 4) (Golgi-localized phosphoprotein of 130 kDa) (Golgi phosphoprotein of 130 kDa)	EBI-10996616	0.35
O14925	Mitochondrial import inner membrane translocase subunit Tim23	EBI-10996616	0.35
Q9BUK6	Protein misato homolog 1	EBI-10996616	0.35
O94822	E3 ubiquitin-protein ligase listerin (EC 2.3.2.27) (RING finger protein 160) (RING-type E3 ubiquitin transferase listerin) (Zinc finger protein 294)	EBI-10996616	0.35
J3QLU9	Receptor protein-tyrosine kinase (EC 2.7.10.1)	EBI-10996616	0.35
H7C2E6	Fanconi anemia core complex-associated protein 20	EBI-10996616	0.35
O14828	Secretory carrier-associated membrane protein 3 (Secretory carrier membrane protein 3)	EBI-10996616	0.35
Q06830	Peroxiredoxin-1 (EC 1.11.1.24) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1)	EBI-10996616	0.35
Q5XPI4	E3 ubiquitin-protein ligase RNF123 (EC 2.3.2.27) (Kip1 ubiquitination-promoting complex protein 1) (RING finger protein 123) (RING-type E3 ubiquitin transferase RNF123)	EBI-10996616	0.35
Q9BX66	Sorbin and SH3 domain-containing protein 1 (Ponsin) (SH3 domain protein 5) (SH3P12) (c-Cbl-associated protein) (CAP)	EBI-10996616	0.35
Q9HBH0	Rho-related GTP-binding protein RhoF (Rho family GTPase Rif) (Rho in filopodia)	EBI-10996616	0.35
Q5VYS8	Terminal uridylyltransferase 7 (TUTase 7) (EC 2.7.7.52) (Zinc finger CCHC domain-containing protein 6)	EBI-10996616	0.35
Q10471	Polypeptide N-acetylgalactosaminyltransferase 2 (EC 2.4.1.41) (Polypeptide GalNAc transferase 2) (GalNAc-T2) (pp-GaNTase 2) (Protein-UDP acetylgalactosaminyltransferase 2) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2) [Cleaved into: Polypeptide N-acetylgalactosaminyltransferase 2 soluble form]	EBI-10996616	0.35
P50570	Dynamin-2 (EC 3.6.5.5)	EBI-10996616	0.35
O95149	Snurportin-1 (RNA U transporter 1)	EBI-10996616	0.35
O00231	26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit RPN6) (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5)	EBI-10996616	0.35
P51532	Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Mitotic growth and transcription activator) (Protein BRG-1) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4)	EBI-10996616	0.35
P32119	Peroxiredoxin-2 (EC 1.11.1.24) (Natural killer cell-enhancing factor B) (NKEF-B) (PRP) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thioredoxin-dependent peroxiredoxin 2)	EBI-10996616	0.35

Cross-References

Database	Links
UNIPROT	Q921T2 E9QLK1 Q1EQW1 Q3U7A4
Pfam	PF05609

Torsin-1A-interacting protein 1 (Mus musculus)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (31 interactors)

Cross-References

Database

Links

Description

Description