Ras-related protein Rab-1B - Homo sapiens

Ras-related protein Rab-1B (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ras-related protein Rab-1B
Accession Code	Q9H0U4
Gene	RAB1B
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 201)
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRG AHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQ AFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

Structure Viewer (PDB: 5O74)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:11389151}. Membrane {Experimental EvidencePubMed:11389151}; Lipid-anchor {Experimental EvidencePubMed:11389151}; Cytoplasmic side {Experimental EvidencePubMed:11389151}. Preautophagosomal structure membrane {ECO:0000269\|PubMed:20545908}; Lipid-anchor {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:P10536}. Note=Targeted by REP1 to membranes of specific subcellular compartments including endoplasmic reticulum, Golgi apparatus, and intermediate vesicles between these two compartments (PubMed:11389151). In the GDP-form, colocalizes with GDI in the cytoplasm (PubMed:11389151). Co-localizes with MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment and to the peri- Golgi region (By similarity). {ECO:0000250\|UniProtKB:P10536, Experimental EvidencePubMed:11389151}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	Experimental Evidence {ECO:0000269\|PubMed:8836150}
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Endoplasmic Reticulum Membrane (GO:0005789) Endoplasmic Reticulum-Golgi Intermediate Compartment Membrane (GO:0033116) Extracellular Exosome (GO:0070062) Golgi Apparatus (GO:0005794) Golgi Membrane (GO:0000139) Perinuclear Region Of Cytoplasm (GO:0048471) Phagophore Assembly Site Membrane (GO:0034045) Transport Vesicle (GO:0030133)

Biology & Function

Description
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes (PubMed:20545908, PubMed:9437002). Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (PubMed:9437002). Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum (PubMed:20545908). Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments (By similarity). Required to modulate the compacted morphology of the Golgi (PubMed:26209634). Promotes the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment (By similarity). {By SimilarityUniProtKB:P10536, Experimental EvidencePubMed:20545908, Experimental EvidencePubMed:26209634, Experimental EvidencePubMed:9437002}.
Assigned Ontology terms

Biological Process	Autophagosome Assembly (GO:0000045) Endoplasmic Reticulum To Golgi Vesicle-Mediated Transport (GO:0006888) Golgi Organization (GO:0007030) Intracellular Protein Transport (GO:0006886) Positive Regulation Of Glycoprotein Metabolic Process (GO:1903020) Regulation Of Autophagosome Assembly (GO:2000785) Virion Assembly (GO:0019068)
Molecular Function	G Protein Activity (GO:0003925) GTP Binding (GO:0005525) GTPase Activity (GO:0003924)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P04626	Receptor tyrosine-protein kinase erbB-2	EBI-32718334	0.35
Interactions with other proteins (48 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8TDZ2	[F-actin]-monooxygenase MICAL1 (EC 1.14.13.225) (EC 1.6.3.1) (Molecule interacting with CasL protein 1) (MICAL-1) (NEDD9-interacting protein with calponin homology and LIM domains)	EBI-7566160	0.37
Q08379	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	EBI-7566236	0.37
Q8N2Y8	AP-4 complex accessory subunit RUSC2 (Interacting protein of Rab1) (Iporin) (RUN and SH3 domain-containing protein 2)	EBI-7566282	0.57
P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	EBI-1060209	0.00
P23508	Colorectal mutant cancer protein (Protein MCC)	EBI-1064480	0.00
P01889	HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B)	EBI-1082004	0.00
A0A6H3AKP3	Putative membrane protein	EBI-2824082	0.00
Q8TAQ2	SWI/SNF complex subunit SMARCC2 (BRG1-associated factor 170) (BAF170) (SWI/SNF complex 170 kDa subunit) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2)	EBI-3921327	0.37
Q969M1	Mitochondrial import receptor subunit TOM40B (Protein TOMM40-like)	EBI-3925033	0.37
Q01968	Inositol polyphosphate 5-phosphatase OCRL (EC 3.1.3.36) (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase OCRL-1) (OCRL-1) (Lowe oculocerebrorenal syndrome protein) (Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase) (EC 3.1.3.86)	EBI-8603940	0.67
Q77M19	V protein	EBI-6270503	0.35
Q5ZSM7	LepB	EBI-6666777	0.44
Q14CZ7	FAST kinase domain-containing protein 3, mitochondrial	EBI-11426979	0.35
Q9UKF7	Cytoplasmic phosphatidylinositol transfer protein 1 (Mammalian rdgB homolog beta) (M-rdgB beta) (MrdgBbeta) (Retinal degeneration B homolog beta) (RdgBbeta)	EBI-11687359	0.54
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-11820797	0.59
P47224	Guanine nucleotide exchange factor MSS4 (Rab-interacting factor)	EBI-24554691	0.67
Q8WUD1	Ras-related protein Rab-2B (EC 3.6.5.2)	EBI-21500361	0.35
Q92930	Ras-related protein Rab-8B	EBI-21858952	0.35
Q92696	Geranylgeranyl transferase type-2 subunit alpha (EC 2.5.1.60) (Geranylgeranyl transferase type II subunit alpha) (Rab geranyl-geranyltransferase subunit alpha) (Rab GG transferase alpha) (Rab GGTase alpha) (Rab geranylgeranyltransferase subunit alpha)	EBI-21858952	0.35
P50395	Rab GDP dissociation inhibitor beta (Rab GDI beta) (Guanosine diphosphate dissociation inhibitor 2) (GDI-2)	EBI-21858952	0.35
P31150	Rab GDP dissociation inhibitor alpha (Rab GDI alpha) (Guanosine diphosphate dissociation inhibitor 1) (GDI-1) (Oligophrenin-2) (Protein XAP-4)	EBI-21858952	0.35
P26374	Rab proteins geranylgeranyltransferase component A 2 (Choroideremia-like protein) (Rab escort protein 2) (REP-2)	EBI-21858952	0.35
P24386	Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein) (Rab escort protein 1) (REP-1) (TCD protein)	EBI-21858952	0.35
P62820	Ras-related protein Rab-1A (EC 3.6.5.2) (YPT1-related protein)	EBI-21858793	0.35
Q08484	GTPase-activating protein GYP1 (GAP for YPT1)	EBI-15592637	0.44
Q5ZWZ3	LidA	EBI-15948833	0.62
Q9NS69	Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)	EBI-16802054	0.27
P25786	Proteasome subunit alpha type-1 (30 kDa prosomal protein) (PROS-30) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain)	EBI-16797676	0.27
P51151	Ras-related protein Rab-9A	EBI-16798617	0.27
P36957	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K)	EBI-20305285	0.35
P08559	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)	EBI-20306509	0.35
P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	EBI-20799058	0.35
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
Q8N6Q3	CD177 antigen (Human neutrophil alloantigen 2a) (HNA-2a) (NB1 glycoprotein) (NB1 GP) (Polycythemia rubra vera protein 1) (PRV-1) (CD antigen CD177)	EBI-21402192	0.35
Q9ULR3	Protein phosphatase 1H (EC 3.1.3.16)	EBI-22223639	0.35
P51636	Caveolin-2	EBI-25394431	0.35
O84232	IncA protein	EBI-22302753	0.40
A0A0H3LG06	ESAT-6-like protein	EBI-25401076	0.35
Q29ST3	Multifunctional virulence effector protein DrrA (Defects in Rab1 recruitment protein A) [Includes: Protein adenylyltransferase (AMPylator) (EC 2.7.7.n1) (Protein guanylyltransferase) (GMPylator) (EC 2.7.7.n6); Rab1 guanine nucleotide exchange factor]	EBI-25611201	0.40
Q9C0B5	Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375)	EBI-25637382	0.35
Q5EP34	Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2)	EBI-25772822	0.35
Q13618	Cullin-3 (CUL-3)	EBI-26367302	0.35
Q13363	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-)	EBI-27044482	0.35
Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	EBI-27110926	0.35
Q8NCK7	Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11)	EBI-27103180	0.35
P42695	Condensin-2 complex subunit D3 (Non-SMC condensin II complex subunit D3) (hCAP-D3)	EBI-28951349	0.35
Q06418	Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF)	EBI-32719716	0.35
Q06124	Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3)	EBI-32723738	0.27

Cross-References

Database	Links
UNIPROT	Q9H0U4 A8K7S1
PDB	3JZA 3NKV 4HLQ 4I1O 5O74 5SZH 5SZK 6SKU
Pfam	PF00071
PROSITE	PS51419
OMIM	612565
DisGeNET	81876

Ras-related protein Rab-1B (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 5O74)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (48 interactors)

Cross-References

Database

Links

Description

Description