Syncoilin - Homo sapiens

Syncoilin (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Syncoilin
Accession Code	Q9H7C4
Gene	SYNC
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 482)
MASPEPRRGGDGAAQAARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDETLYVQETEKAEEALYIEEAMQPDEALHVEEPGNPEETVCVEETTEPDRIQFVEGPVEPGKP TSPEHVVYEGETVTRAEKSNPEESLRAEQSPSMEENLSIEDLELLEGRFQQCVQAVAQLEEERDQLIHELVLLREPALQEVQQVHQDILAAYKLHAQAELERDGLREEIRLVKQKLFKVTKECVAYQYQL ECRQQDVAQFADFREVLTTRATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNR NLEDQIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q9EPM5}. Note=In skeletal muscle, colocalizes with DES and DTNA, and is localized at the myotendinous and neuromuscular junctions, sarcolemma and Z-lines. In myotubes, detected in a punctate cytoplasmic pattern (By similarity). {By SimilarityUniProtKB:Q9EPM5}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Intermediate Filament (GO:0005882) Neuromuscular Junction (GO:0031594) Perinuclear Region Of Cytoplasm (GO:0048471) Sarcolemma (GO:0042383) Z Disc (GO:0030018)

Biology & Function

Description
Atypical type III intermediate filament (IF) protein that may play a supportive role in the efficient coupling of mechanical stress between the myofibril and fiber exterior. May facilitate lateral force transmission during skeletal muscle contraction. Does not form homofilaments nor heterofilaments with other IF proteins. {By SimilarityUniProtKB:Q9EPM5}.
Assigned Ontology terms

Biological Process	Intermediate Filament-Based Process (GO:0045103)
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q13137	Calcium-binding and coiled-coil domain-containing protein 2	EBI-21702482	0.35
Q9BV73	Centrosome-associated protein CEP250	EBI-21702482	0.35
Q13393	Phospholipase D1	EBI-25882515	0.56
Interactions with other proteins (47 interactors)

Partner (UniProt)		IntAct	Confidence score
P08670	Vimentin	EBI-25896426	0.56
Q8TEQ6	Gem-associated protein 5 (Gemin5)	EBI-11086338	0.35
P20152	Vimentin	EBI-11150248	0.35
O15061	Synemin (Desmuslin)	EBI-21702482	0.35
Q9Y6K9	NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)	EBI-21702482	0.35
Q9Y2X7	ARF GTPase-activating protein GIT1 (ARF GAP GIT1) (Cool-associated and tyrosine-phosphorylated protein 1) (CAT-1) (CAT1) (G protein-coupled receptor kinase-interactor 1) (GRK-interacting protein 1) (p95-APP1)	EBI-21702482	0.35
Q9P2K6	Kelch-like protein 42 (Cullin-3-binding protein 9) (Ctb9) (Kelch domain-containing protein 5)	EBI-21702482	0.35
Q9NS87	Kinesin-like protein KIF15 (Kinesin-like protein 2) (hKLP2) (Kinesin-like protein 7) (Serologically defined breast cancer antigen NY-BR-62)	EBI-21702482	0.35
Q9H2U2	Inorganic pyrophosphatase 2, mitochondrial (EC 3.6.1.1) (Pyrophosphatase SID6-306) (Pyrophosphate phospho-hydrolase 2) (PPase 2)	EBI-21702482	0.35
Q9H2C0	Gigaxonin (Kelch-like protein 16)	EBI-21702482	0.35
Q9BZF9	Uveal autoantigen with coiled-coil domains and ankyrin repeats	EBI-21702482	0.35
Q96T51	RUN and FYVE domain-containing protein 1 (FYVE-finger protein EIP1) (La-binding protein 1) (Rab4-interacting protein) (Zinc finger FYVE domain-containing protein 12)	EBI-21702482	0.35
Q96JN2	Coiled-coil domain-containing protein 136 (Nasopharyngeal carcinoma-associated gene 6 protein)	EBI-21702482	0.35
Q96EK4	THAP domain-containing protein 11	EBI-21702482	0.35
Q96A19	Coiled-coil domain-containing protein 102A	EBI-21702482	0.35
Q8TBA6	Golgin subfamily A member 5 (Cell proliferation-inducing gene 31 protein) (Golgin-84) (Protein Ret-II) (RET-fused gene 5 protein)	EBI-21702482	0.35
Q8IWJ2	GRIP and coiled-coil domain-containing protein 2 (185 kDa Golgi coiled-coil protein) (GCC185) (CLL-associated antigen KW-11) (CTCL tumor antigen se1-1) (Ran-binding protein 2-like 4) (RanBP2L4) (Renal carcinoma antigen NY-REN-53)	EBI-21702482	0.35
Q6P4E1	Protein GOLM2 (Cancer susceptibility candidate gene 4 protein) (CASC4) (Golgi membrane protein 2)	EBI-21702482	0.35
Q5JTD0	Tight junction-associated protein 1 (Protein incorporated later into tight junctions) (Tight junction protein 4)	EBI-21702482	0.35
Q53EZ4	Centrosomal protein of 55 kDa (Cep55) (Up-regulated in colon cancer 6)	EBI-21702482	0.35
Q16352	Alpha-internexin (Alpha-Inx) (66 kDa neurofilament protein) (NF-66) (Neurofilament-66) (Neurofilament 5)	EBI-21702482	0.35
Q15750	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 1) (TGF-beta-activated kinase 1-binding protein 1) (TAK1-binding protein 1)	EBI-21702482	0.35
Q15276	Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17)	EBI-21702482	0.35
Q15052	Rho guanine nucleotide exchange factor 6 (Alpha-Pix) (COOL-2) (PAK-interacting exchange factor alpha) (Rac/Cdc42 guanine nucleotide exchange factor 6)	EBI-21702482	0.35
Q15025	TNFAIP3-interacting protein 1 (A20-binding inhibitor of NF-kappa-B activation 1) (ABIN-1) (HIV-1 Nef-interacting protein) (Nef-associated factor 1) (Naf1) (Nip40-1) (Virion-associated nuclear shuttling protein) (VAN) (hVAN)	EBI-21702482	0.35
Q14BN4	Sarcolemmal membrane-associated protein (Sarcolemmal-associated protein)	EBI-21702482	0.35
Q14161	ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2)	EBI-21702482	0.35
Q14155	Rho guanine nucleotide exchange factor 7 (Beta-Pix) (COOL-1) (PAK-interacting exchange factor beta) (p85)	EBI-21702482	0.35
Q08378	Golgin subfamily A member 3 (Golgi complex-associated protein of 170 kDa) (GCP170) (Golgin-160)	EBI-21702482	0.35
P48681	Nestin	EBI-21702482	0.35
P41219	Peripherin (Neurofilament 4)	EBI-21702482	0.35
P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	EBI-21702482	0.35
P23508	Colorectal mutant cancer protein (Protein MCC)	EBI-21702482	0.35
P17661	Desmin	EBI-21702482	0.35
P14136	Glial fibrillary acidic protein (GFAP)	EBI-25858572	0.56
P07197	Neurofilament medium polypeptide (NF-M) (160 kDa neurofilament protein) (Neurofilament 3) (Neurofilament triplet M protein)	EBI-21702482	0.35
P07196	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	EBI-25877887	0.56
O43318	Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1)	EBI-21702482	0.35
O14777	Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC)	EBI-21702482	0.35
P61604	10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (Chaperonin 10) (CPN10) (Early-pregnancy factor) (EPF)	EBI-20900543	0.40
Q8TDR0	TRAF3-interacting protein 1 (Interleukin-13 receptor alpha 1-binding protein 1) (Intraflagellar transport protein 54 homolog) (Microtubule-interacting protein associated with TRAF3) (MIP-T3)	EBI-21389780	0.00
P68133	Actin, alpha skeletal muscle (EC 3.6.4.-) (Alpha-actin-1) [Cleaved into: Actin, alpha skeletal muscle, intermediate form]	EBI-25830425	0.56
P13637	Sodium/potassium-transporting ATPase subunit alpha-3 (Na(+)/K(+) ATPase alpha-3 subunit) (EC 7.2.2.13) (Na(+)/K(+) ATPase alpha(III) subunit) (Sodium pump subunit alpha-3)	EBI-25832791	0.56
P16284	Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31)	EBI-25881579	0.56
P20339	Ras-related protein Rab-5A (EC 3.6.5.2)	EBI-25889147	0.56
O76024	Wolframin	EBI-25899416	0.56
O60333	Kinesin-like protein KIF1B (Klp)	EBI-25916238	0.56

Cross-References

Database	Links
UNIPROT	Q9H7C4 B4DNK8 B4DY58 C9IY41
Pfam	PF00038
PROSITE	PS51842
OMIM	611750
DisGeNET	81493

Syncoilin (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (47 interactors)

Cross-References

Database

Links

Description

Description