Calcium-binding protein 2 - Homo sapiens

Calcium-binding protein 2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Calcium-binding protein 2
Accession Code	Q9NPB3
Gene	CABP2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 220)
MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGK VDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSR

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:19338761}. Cell membrane {Experimental EvidencePubMed:19338761}; Lipid-anchor {Experimental EvidencePubMed:19338761}; Cytoplasmic side {Experimental EvidencePubMed:19338761}. Golgi apparatus {Experimental EvidencePubMed:19338761}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	Experimental Evidence {ECO:0000269\|PubMed:10625670}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Golgi Apparatus (GO:0005794) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Required for sound encoding at inner hair cells (IHCs) synapses, likely via inhibition of the inactivation of voltage-gated calcium channel of type 1.3 (Cav1.3) in the IHCs (PubMed:28183797). Required for the normal transfer of light signals through the retina (By similarity). {By SimilarityUniProtKB:Q9JLK4, Experimental EvidencePubMed:28183797}.
Assigned Ontology terms

Biological Process	Regulation Of Voltage-Gated Calcium Channel Activity (GO:1901385) Sensory Perception Of Sound (GO:0007605) Signal Transduction (GO:0007165) Visual Perception (GO:0007601)
Molecular Function	Calcium Channel Regulator Activity (GO:0005246) Calcium Ion Binding (GO:0005509)

Disease associations

Description
Deafness, autosomal recessive, 93 (DFNB93) [MIM:614899]: A form of non-syndromic deafness characterized by stable, bilateral, symmetric, prelingual moderate to severe deafness. Hearing impairment is slightly more pronounced in the mid-frequencies, resulting in a distinctive shallow U-shaped audiogram. {Experimental EvidencePubMed:22981119, Experimental EvidencePubMed:28183797}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	607314 614899
DisGeNET	51475

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q7Z3Z2	Protein RD3	EBI-24796266	0.56
Interactions with other proteins (32 interactors)

Partner (UniProt)		IntAct	Confidence score
Q5JST6	EF-hand domain-containing family member C2	EBI-24280036	0.56
Q9H257	Caspase recruitment domain-containing protein 9 (hCARD9)	EBI-24349898	0.56
A6NEM1	Golgin subfamily A member 6-like protein 9	EBI-24354781	0.56
Q96ED9	Protein Hook homolog 2 (h-hook2) (hHK2)	EBI-24363653	0.56
P86480	Proline-rich protein 20D	EBI-25247799	0.56
Q96M29	Tektin-5	EBI-25252219	0.56
Q9NPE3	H/ACA ribonucleoprotein complex subunit 3 (Nucleolar protein 10) (Nucleolar protein family A member 3) (snoRNP protein NOP10)	EBI-23679380	0.56
Q5T686	Arginine vasopressin-induced protein 1 (AVP-induced protein 1)	EBI-23682258	0.56
Q9H1P6	Uncharacterized protein C20orf85	EBI-24667738	0.56
Q8IZF2	Adhesion G protein-coupled receptor F5 (G-protein coupled receptor 116)	EBI-23695711	0.56
Q9BRK3	Matrix remodeling-associated protein 8 (Limitrin)	EBI-23698200	0.56
Q5JTJ3	Cytochrome c oxidase assembly factor 6 homolog	EBI-23706738	0.56
Q6NX45	Zinc finger protein 774	EBI-24681698	0.56
A8K8V0	Zinc finger protein 785	EBI-23728536	0.56
P52738	Zinc finger protein 140	EBI-23735866	0.56
O43623	Zinc finger protein SNAI2 (Neural crest transcription factor Slug) (Protein snail homolog 2)	EBI-24705441	0.56
Q9BU61	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3	EBI-24705993	0.56
Q9BRJ7	Tudor-interacting repair regulator protein (NUDT16-like protein 1) (Protein syndesmos)	EBI-24717821	0.56
Q8NCR6	Spermatid-specific manchette-related protein 1 (Ciliated bronchial epithelial protein 1) (Testis development protein NYD-SP22)	EBI-24726274	0.56
Q8N6D5	Ankyrin repeat domain-containing protein 29	EBI-24738691	0.56
O00746	Nucleoside diphosphate kinase, mitochondrial (NDK) (NDP kinase, mitochondrial) (EC 2.7.4.6) (Nucleoside diphosphate kinase D) (NDPKD) (nm23-H4)	EBI-23809170	0.56
P19237	Troponin I, slow skeletal muscle (Troponin I, slow-twitch isoform)	EBI-24741126	0.56
Q9UPQ4	E3 ubiquitin-protein ligase TRIM35 (EC 2.3.2.27) (Hemopoietic lineage switch protein 5)	EBI-24765776	0.56
A0A0U1RQF7	DPEP2 neighbor protein	EBI-25278632	0.56
Q9H9P5	Putative E3 ubiquitin-protein ligase UNKL (EC 2.3.2.-) (RING finger protein unkempt-like) (Zinc finger CCCH domain-containing protein 5-like)	EBI-24548110	0.56
Q8TBB0	THAP domain-containing protein 6	EBI-24654317	0.56
Q68EA5	Zinc finger protein 57 (Zinc finger protein 424)	EBI-24654686	0.56
Q9H0A9	Speriolin-like protein (Spermatogenesis and centriole-associated protein 1-like protein)	EBI-24789004	0.56
Q6P5X5	UPF0545 protein C22orf39	EBI-25202133	0.56
Q08117	TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator)	EBI-25267170	0.56
P35452	Homeobox protein Hox-D12 (Homeobox protein Hox-4H)	EBI-25241483	0.56
Q8TAG6	Vexin	EBI-25275160	0.56

Cross-References

Database	Links
UNIPROT	Q9NPB3
Pfam	PF00036 PF13499
PROSITE	PS00018 PS50222
OMIM	607314 614899
DisGeNET	51475

Calcium-binding protein 2 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (32 interactors)

Cross-References

Database

Links

Description

Description