NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Translational regulator orb2 - Drosophila melanogaster - NucEnvDB

Translational regulator orb2 (Drosophila melanogaster)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Translational regulator orb2
Accession Code	Q9VSR3
Gene	orb2
Organism	Drosophila melanogaster (Taxonomy: 7227)
Part of Reference Proteome?	Yes
Sequence (Length: 704)
MDSLKLPKANSATSSASGSNSNLSGSTSASASAATSPTSSGTAVGGILSGAPKSPPGLGSSTPISVRFNANEESLDDILQ SFHHSKHSPSGGASGGGDASPTSNLLGMKNNGLGLVVGNCDSLSSSPSQPQMHAGSASLFGNDEVSLRNNFMQAGGFFNR KSCGGLPNLNLNKPPQLHQQQHQQQHQQHQQHQQQQQLHQHQQQLSPNLSALHHHHQQQQQLRESGGSHSPSSPGGGGGG SPYNGSQAGCSSGGISPIPPQMGVSPKYRRSISFPIKGNSPTAIYGNMHMDGMGSGHMNIPTLSIGNGGGGGSTGMVSAG ATGGGDAPYLGNSYGNMMTSNGQMHHGGGLDNSLCDYMRNMSLGGNGGGDGSNSMSLMQDRMRVMGGPKHLSEADAMAIA ASGNDPSVYLNALKMGSPSRLSPHSPHSPIQGGNGGNVGDGTARFSRKVFVGGLPPDIDEDEITTSFRRFGPLVVDWPHK AESKSYFPPKGYAFLLFQDESSVQQLIDSCITDEDKLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVG GVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQ MCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGADRPRAVPFRWC

Structure Viewer (PDB: 6VPS)

Subcellular Location

Description
Perikaryon {Experimental EvidencePubMed:21900268}. Cell projection, axon {Experimental EvidencePubMed:21900268}. Cell projection, dendrite {Experimental EvidencePubMed:21900268}. Synapse {Experimental EvidencePubMed:22284910, Experimental EvidencePubMed:23083740, Experimental EvidencePubMed:24523662}. Cytoplasm {Experimental EvidencePubMed:21900268, ECO:0000269\|PubMed:23209437}. Cytoplasm, perinuclear region {ECO:0000269\|PubMed:23209437}. Note=In embryonic and larval nervous system, concentrated in the perikaryon (PubMed:21900268). In the adult central nervous system, localizes to synaptic terminals (PubMed:21900268). In the ovary, localizes to the cytoplasm of nurse cells (PubMed:21900268). Localizes to neuromuscular junctions (PubMed:29105522). In spermatocytes, localizes throughout the cytoplasm with higher levels concentrated in a ring around the nucleus (PubMed:23209437). The oligomeric form is enriched in the synaptic region (PubMed:22284910). {Experimental EvidencePubMed:21900268, Experimental EvidencePubMed:22284910, ECO:0000269\|PubMed:29105522}. [Isoform A]: Synapse {ECO:0000269\|PubMed:26095367}. [Isoform B]: Perikaryon {ECO:0000269\|PubMed:26095367}. Cell projection, axon {ECO:0000269\|PubMed:26095367}. Synapse {ECO:0000269\|PubMed:26095367}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Axon (GO:0030424) Axon Terminus (GO:0043679) Cell Body (GO:0044297) Cell Cortex (GO:0005938) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dendrite Terminus (GO:0044292) Messenger Ribonucleoprotein Complex (GO:1990124) Neuron Projection (GO:0043005) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Postsynapse (GO:0098794) Presynapse (GO:0098793) Protein-Containing Complex (GO:0032991) Synapse (GO:0045202) Synaptic Membrane (GO:0097060)

Biology & Function

Description
RNA-binding protein involved in translational regulation and required for long-term memory (PubMed:28525754, PubMed:29105522). Required in mushroom body gamma neurons for long-term memory in male courtship (PubMed:17965711, PubMed:23083740). Binds to mRNA 3'-UTRs (PubMed:20547833, PubMed:26638074, PubMed:24830287, PubMed:26095367, PubMed:32165583). In its monomeric form, acts as a translational repressor of genes involved in neuronal growth, synapse formation and protein turnover (PubMed:20547833, PubMed:26638074, PubMed:32165583). In its amyloid-like oligomeric form, acts as a translational activator (PubMed:26638074, PubMed:32165583). The monomeric form reduces poly(A) tail length and destabilizes mRNA while the oligomeric form protects and elongates the poly(A) tail and stabilizes mRNA (PubMed:26638074). Involved in asymmetric cell division in the central nervous system (PubMed:21900268). Plays a role in synapse formation and morphology at neuromuscular junctions by modulating the translation of the tumor suppressor brat (PubMed:29105522). Required for the progression of spermatogenesis through meiosis and for sperm differentiation (PubMed:23209437). During sperm differentiation, required to asymmetrically localize and activate the translation of protein kinase aPKC mRNAs which is necessary for spermatid cyst polarization (PubMed:24830287). Also required during spermatid cyst polarization for localization and translation of its own mRNA (PubMed:24830287). {Experimental EvidencePubMed:17965711, Experimental EvidencePubMed:20547833, Experimental EvidencePubMed:21900268, Experimental EvidencePubMed:23083740, Experimental EvidencePubMed:23209437, Experimental EvidencePubMed:24830287, Experimental EvidencePubMed:26095367, Experimental EvidencePubMed:26638074, Experimental EvidencePubMed:28525754, Experimental EvidencePubMed:29105522, Experimental EvidencePubMed:32165583}. [Isoform A]: Required for initial memory acquisition (PubMed:26095367, PubMed:28525754). Following subsequent late dopaminergic pathway activation, recruits isoform B into a complex to activate translation of CaMKII which is required for long-term memory consolidation (PubMed:26095367). {Experimental EvidencePubMed:26095367, Experimental EvidencePubMed:28525754}.
Assigned Ontology terms

Biological Process	Asymmetric Cell Division (GO:0008356) Long-Term Memory (GO:0007616) Male Courtship Behavior (GO:0008049) Male Meiosis I (GO:0007141) Negative Regulation Of Cytoplasmic Translation (GO:2000766) Negative Regulation Of Translation (GO:0017148) Positive Regulation Of Translation (GO:0045727) Protein Stabilization (GO:0050821) Sperm Axoneme Assembly (GO:0007288) Sperm Individualization (GO:0007291) Spermatogenesis (GO:0007283)
Molecular Function	Identical Protein Binding (GO:0042802) MRNA 3'-UTR Binding (GO:0003730) MRNA Regulatory Element Binding Translation Repressor Activity (GO:0000900) Ribosome Binding (GO:0043022) RNA Binding (GO:0003723) Translation Activator Activity (GO:0008494) Translation Factor Activity, RNA Binding (GO:0008135)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9VSR3	Self	EBI-16193652	0.60
Interactions with other proteins (13 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8T498	Ras GTPase-activating protein raskol	EBI-266854	0.00
Q9VXJ9	Transducer of ERBB2, isoform A (Transducer of ERBB2, isoform F)	EBI-279104	0.00
Q7KNM2	Dorsal interacting protein 4 (GEO03784p1) (GM08377p) (Lesswright, isoform A) (Lesswright, isoform B) (Lesswright, isoform C) (Lesswright, isoform D) (RE25737p) (Ubiquitin-conjugating enzyme 9) (Ubiquitin-conjugating enzyme 9 homolog)	EBI-469685	0.00
Q9VJK3	AT27976p (GEO08792p1) (Uncharacterized protein, isoform A) (Uncharacterized protein, isoform B)	EBI-469712	0.00
P13238	Vitelline membrane protein Vm26Ab (Protein SV23) (Protein TU-4)	EBI-469751	0.00
O76136	Homeodomain protein	EBI-469970	0.00
Q27297	DNA repair protein Rad51 homolog (Protein spindle-A) (RecA protein homolog)	EBI-470372	0.00
Q961D1	Cyclin K, isoform A (EC 2.7.1.-) (Cyclin K, isoform B) (Cyclin K, isoform C) (LD21709p)	EBI-470579	0.00
Q9VYF9	RE28286p	EBI-470732	0.00
B6VQA1	Protein dimmed	EBI-470876	0.00
Q27889	Serine/threonine-protein phosphatase 2B catalytic subunit 2 (EC 3.1.3.16) (Calmodulin-dependent calcineurin A2 subunit)	EBI-471017	0.00
P07548	Homeotic protein deformed	EBI-471068	0.00
Q0E8J0	MEP-1, isoform A (MEP-1, isoform B) (MEP-1, isoform C) (MEP-1, isoform D) (MEP-1, isoform E) (MEP-1, isoform F) (MEP-1, isoform G)	EBI-471797	0.00

Cross-References

Database	Links
UNIPROT	Q9VSR3 Q95T31 Q9VSR2
PDB	6VPS
Pfam	PF16366 PF16367
PROSITE	PS50102

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK