NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

B-cell lymphoma 3 protein homolog - Mus musculus - NucEnvDB

B-cell lymphoma 3 protein homolog (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	B-cell lymphoma 3 protein homolog
Accession Code	Q9Z2F6
Gene	Bcl3
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 448)
MPRCPAGAMDEGPVDLRTRPKGTPGAALPLRKRPLRPASPEPATTRSPAGPLDALRSGCDVPVVPGPPHCVARPEALYYQGPLMPIYSTPTMAPHFPLLNLPTHPYSMICPMEHPLSADIAMATRVDEDG DTPLHIAVVQNNIAAVYRILSLFKLGSREVDVHNNLRQTPLHLAVITTLPDMVRLLVTAGASPMALDRHGQTAIHLACEHRSPSCLQALLDSATSGSVDLEVRNYEGLTALHVAVNTGCQEAVLLLLERG ADIDAVDIKSGRSPLIHAVENNSLNMVQLLLLHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVIDILRGKASRAASGSQPEPSPDQSATNSPESSSRLSSNGLQ SSPSSSPSLSPPKDAPGFPATPQNFFLPTTSTPAFLPFPGVLRGPGRPVPPSPAPGSS

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:16713561}. Cytoplasm {Experimental EvidencePubMed:16713561}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:16713561}. Note=Ubiquitination via 'Lys-63'-linked ubiquitin chains is required for nuclear accumulation.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Bcl3-Bcl10 Complex (GO:0032996) Bcl3/NF-KappaB2 Complex (GO:0033257) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Intracellular Membrane-Bounded Organelle (GO:0043231) Midbody (GO:0030496) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Protein-Containing Complex (GO:0032991)

Biology & Function

Description
Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit (By similarity). In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation. {By Similarity, Experimental EvidencePubMed:16713561}.
Assigned Ontology terms

Biological Process	Antimicrobial Humoral Response (GO:0019730) Cellular Response To DNA Damage Stimulus (GO:0006974) Defense Response To Bacterium (GO:0042742) Defense Response To Protozoan (GO:0042832) DNA Damage Response, Signal Transduction By P53 Class Mediator (GO:0030330) Extracellular Matrix Organization (GO:0030198) Follicular Dendritic Cell Differentiation (GO:0002268) Germinal Center Formation (GO:0002467) Humoral Immune Response Mediated By Circulating Immunoglobulin (GO:0002455) I-KappaB Kinase/NF-KappaB Signaling (GO:0007249) Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage By P53 Class Mediator (GO:0042771) Marginal Zone B Cell Differentiation (GO:0002315) Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Negative Regulation Of Interleukin-8 Production (GO:0032717) Negative Regulation Of NF-KappaB Transcription Factor Activity (GO:0032088) Negative Regulation Of Receptor Signaling Pathway Via JAK-STAT (GO:0046426) Negative Regulation Of T Cell Apoptotic Process (GO:0070233) Negative Regulation Of Tumor Necrosis Factor Production (GO:0032720) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of Type II Interferon Production (GO:0032729) Positive Regulation Of Interleukin-10 Production (GO:0032733) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Positive Regulation Of Translation (GO:0045727) Protein Import Into Nucleus (GO:0006606) Regulation Of Apoptotic Process (GO:0042981) Regulation Of DNA Binding (GO:0051101) Regulation Of NIK/NF-KappaB Signaling (GO:1901222) Response To UV-C (GO:0010225) Response To Virus (GO:0009615) Spleen Development (GO:0048536) T Cell Apoptotic Process (GO:0070231) T-Helper 1 Type Immune Response (GO:0042088) T-Helper 2 Cell Differentiation (GO:0045064)
Molecular Function	DNA-Binding Transcription Factor Binding (GO:0140297) Histone Deacetylase Binding (GO:0042826) Protein-Macromolecule Adaptor Activity (GO:0030674) Transcription Coactivator Activity (GO:0003713) Transcription Corepressor Activity (GO:0003714)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q80TQ2	Ubiquitin carboxyl-terminal hydrolase CYLD	EBI-943890	0.67

Cross-References

Database	Links
UNIPROT	Q9Z2F6
Pfam	PF00023 PF12796
PROSITE	PS50297 PS50088

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK