Fibronectin type III and SPRY domain-containing protein 2 - Homo sapiens

Fibronectin type III and SPRY domain-containing protein 2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Fibronectin type III and SPRY domain-containing protein 2
Accession Code	A1L4K1
Gene	FSD2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 749)
MEEESGEELGLDRSTPKDFHFYHMDLYDSEDRLHLFPEENTRMRKVVQAEMANESRGAGDGKAQRDLQEEVDELVHLYGLEDDHELGDEFVDENIPRTGVSEYPPYMMKRRDPAREQRDWRLSGEAAEAE DLGFGGWGSAGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAADVFCVTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIEMENFANHLEEVFITVEENFGKQEQNFESHYN EILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENLDTCKELMETIEEMCHEEKVDFIKDAVAMADRLGKFLKTKTDVEISAQPEFEDQTLDFSDVEQLMGSINTIPAPSAPVINPQVPNSATGSSV RVCWSLYSDDTVESYQLSYRPVQDSSPGTDQAEFTVTVKETYCSVTNLVPNTQYEFWVTAHNRAGPSPSSERAVYMTAPSPPIIKTKEIRSCEEAVLICWESGNLNPVDSYTVELTQAESPEASGVTESV VGIPTCESVVQLQPGRSYIIYVRALNMGGPSVRSEPATVHTIGSYFRLNKDTCHPWLTISEDGLTAVRSERRTPARELSPSDTHFTRCVAVMGNLIPVRGHHYWEVEVDEHLDYRVGVAFADVRKQEDLG ANCLSWCMRHTFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYEHSKLSFFNVDLSQHLYTFSCQLHEFVHPCFSLEKPGCLKVHNGISMPKHVTFY

Subcellular Location

Description
Nucleus {By SimilarityUniProtKB:H0UZ81}. Sarcoplasmic reticulum {By SimilarityUniProtKB:H0UZ81}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:H0UZ81}. Note=In skeletal muscles and striated muscles flanks Z-disks. Partially colocalizes with RYR2 in the sarcoplasmic reticulum. {By SimilarityUniProtKB:H0UZ81}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Sarcoplasmic Reticulum (GO:0016529)

Biology & Function

Description

Assigned Ontology terms

Biological Process
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O95295	SNARE-associated protein Snapin	EBI-24500672	0.56
O60645	Exocyst complex component 3	EBI-25258050	0.56
Q06787	Fragile X messenger ribonucleoprotein 1	EBI-10224474	0.56
Interactions with other proteins (93 interactors)

Partner (UniProt)		IntAct	Confidence score
Q14324	Myosin-binding protein C, fast-type (Fast MyBP-C) (C-protein, skeletal muscle fast isoform)	EBI-5661041	0.00
Q7Z3I7	Zinc finger protein 572	EBI-10172604	0.60
Q7Z3B3	KAT8 regulatory NSL complex subunit 1 (MLL1/MLL complex subunit KANSL1) (MSL1 homolog 1) (hMSL1v1) (NSL complex protein NSL1) (Non-specific lethal 1 homolog)	EBI-10178303	0.56
O95990	Actin-associated protein FAM107A (Down-regulated in renal cell carcinoma 1) (Protein TU3A)	EBI-10192906	0.56
P10768	S-formylglutathione hydrolase (FGH) (EC 3.1.2.12) (Esterase D) (Methylumbelliferyl-acetate deacetylase) (EC 3.1.1.56)	EBI-10197227	0.78
P17024	Zinc finger protein 20 (Zinc finger protein KOX13)	EBI-10199416	0.56
P28070	Proteasome subunit beta type-4 (26 kDa prosomal protein) (HsBPROS26) (PROS-26) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome beta chain) (Proteasome chain 3) (HsN3)	EBI-10204607	0.56
P29972	Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Urine water channel) (Water channel protein for red blood cells and kidney proximal tubule)	EBI-10204944	0.56
P31146	Coronin-1A (Coronin-like protein A) (Clipin-A) (Coronin-like protein p57) (Tryptophan aspartate-containing coat protein) (TACO)	EBI-10205786	0.78
Q00994	Protein BEX3 (Brain-expressed X-linked protein 3) (Nerve growth factor receptor-associated protein 1) (Ovarian granulosa cell 13.0 kDa protein HGR74) (p75NTR-associated cell death executor)	EBI-10222282	0.72
Q08117	TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator)	EBI-10224779	0.67
Q14738	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform (PP2A B subunit isoform B'-delta) (PP2A B subunit isoform B56-delta) (PP2A B subunit isoform PR61-delta) (PP2A B subunit isoform R5-delta)	EBI-10233892	0.56
Q15973	Zinc finger protein 124 (Zinc finger protein HZF-16)	EBI-10237322	0.56
Q16670	Zinc finger and SCAN domain-containing protein 26 (Protein SRE-ZBP) (Zinc finger protein 187)	EBI-10238175	0.56
Q3B820	Protein FAM161A	EBI-10240125	0.56
Q53FD0	Zinc finger C2HC domain-containing protein 1C	EBI-10242267	0.56
Q5JS98	Pre-B-cell leukemia transcription factor 3	EBI-10244397	0.56
Q6NYC8	Phostensin (Protein phosphatase 1 F-actin cytoskeleton-targeting subunit) (Protein phosphatase 1 regulatory subunit 18)	EBI-10251682	0.72
Q6P1J9	Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein)	EBI-10252260	0.78
Q6PJG3	LATS1 protein (Serine/threonine-protein kinase LATS1)	EBI-10253974	0.56
Q86VK4	Zinc finger protein 410 (Another partner for ARF 1)	EBI-10259792	0.56
Q86YD7	Protein FAM90A1	EBI-10260722	0.72
Q8IY31	Intraflagellar transport protein 20 homolog (hIFT20)	EBI-10262646	0.56
Q8N381	Phosphoinositide-3-kinase, regulatory subunit 3 (Gamma)	EBI-10265171	0.56
Q8N8B7	Transcription elongation factor A N-terminal and central domain-containing protein (TFIIS central domain-containing protein 1)	EBI-10267719	0.56
Q8NEF3	Coiled-coil domain-containing protein 112 (Mutated in bladder cancer protein 1)	EBI-10270620	0.56
Q8TAU3	Zinc finger protein 417	EBI-10272085	0.72
Q8TD31	Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8)	EBI-10274456	0.72
Q96BZ8	Leukocyte receptor cluster member 1	EBI-10282596	0.72
Q96NC0	Zinc finger matrin-type protein 2	EBI-10291592	0.56
Q96SQ5	Zinc finger protein 587	EBI-10293466	0.72
Q9BXY8	Protein BEX2 (Brain-expressed X-linked protein 2) (hBex2)	EBI-10301478	0.56
Q9H0A9	Speriolin-like protein (Spermatogenesis and centriole-associated protein 1-like protein)	EBI-10304145	0.60
Q9H0E9	Bromodomain-containing protein 8 (Skeletal muscle abundant protein) (Skeletal muscle abundant protein 2) (Thyroid hormone receptor coactivating protein of 120 kDa) (TrCP120) (p120)	EBI-10304359	0.72
Q9H6F0	cDNA: FLJ22332 fis, clone HRC05753	EBI-10307479	0.56
Q9H788	SH2 domain-containing protein 4A (Protein SH(2)A) (Protein phosphatase 1 regulatory subunit 38)	EBI-10308323	0.72
Q9HC52	Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3) (hPc3) (Rectachrome 1)	EBI-10310314	0.72
Q9P0T4	Zinc finger protein 581	EBI-10317754	0.72
Q9UGP5	DNA polymerase lambda (Pol Lambda) (EC 2.7.7.7) (EC 4.2.99.-) (DNA polymerase beta-2) (Pol beta2) (DNA polymerase kappa)	EBI-10320763	0.60
Q9UIE0	Zinc finger protein 230 (Zinc finger protein FDZF2)	EBI-10321904	0.56
Q9Y3B7	39S ribosomal protein L11, mitochondrial (L11mt) (MRP-L11) (Mitochondrial large ribosomal subunit protein uL11m)	EBI-10327384	0.72
Q8IXW7	FMR1 protein (Fragile X messenger ribonucleoprotein 1) (Truncated FMRP)	EBI-21249370	0.37
Q99608	Necdin	EBI-21251010	0.37
Q9H0I2	Enkurin domain-containing protein 1	EBI-24276119	0.56
Q8TBB1	E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX)	EBI-24292204	0.56
Q9P1Y5	Calmodulin-regulated spectrin-associated protein 3 (Protein Nezha)	EBI-24292226	0.56
Q9H9D4	Zinc finger protein 408 (PR domain zinc finger protein 17)	EBI-24302090	0.56
Q5T619	Zinc finger protein 648	EBI-24309981	0.56
Q96EG3	Zinc finger protein 837	EBI-24311294	0.56
Q96AL5	PBX3 protein	EBI-24314166	0.56
Q8IVT4	Hypothetical MGC50722	EBI-24315626	0.56
Q6NX45	Zinc finger protein 774	EBI-24321517	0.56
Q9BT49	THAP domain-containing protein 7	EBI-24325694	0.56
Q9BWG6	Sodium channel modifier 1	EBI-24340348	0.56
Q96HB5	Coiled-coil domain-containing protein 120	EBI-24349830	0.56
Q9UK33	Zinc finger protein 580 (LDL-induced EC protein)	EBI-24352123	0.56
P78358	Cancer/testis antigen 1 (Autoimmunogenic cancer/testis antigen NY-ESO-1) (Cancer/testis antigen 6.1) (CT6.1) (L antigen family member 2) (LAGE-2)	EBI-24352383	0.56
Q96EZ8	Microspherule protein 1 (58 kDa microspherule protein) (Cell cycle-regulated factor p78) (INO80 complex subunit J) (MCRS2)	EBI-24352759	0.56
Q8WWY3	U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31)	EBI-24355284	0.56
O76064	E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8)	EBI-24355797	0.56
Q9ULM2	Zinc finger protein 490	EBI-24362843	0.56
Q96HP4	Oxidoreductase NAD-binding domain-containing protein 1 (EC 1.-.-.-)	EBI-25253734	0.56
O43602	Neuronal migration protein doublecortin (Doublin) (Lissencephalin-X) (Lis-X)	EBI-25254540	0.56
P0CB47	Upstream-binding factor 1-like protein 1	EBI-25255462	0.56
P56524	Histone deacetylase 4 (HD4) (EC 3.5.1.98)	EBI-25255284	0.56
Q3SY00	Testis-specific protein 10-interacting protein (Tsga10-interacting protein)	EBI-25255985	0.56
Q9P2K3	REST corepressor 3	EBI-24366860	0.56
P13682	Zinc finger protein 35 (Zinc finger protein HF.10)	EBI-24478087	0.56
Q07002	Cyclin-dependent kinase 18 (EC 2.7.11.22) (Cell division protein kinase 18) (PCTAIRE-motif protein kinase 3) (Serine/threonine-protein kinase PCTAIRE-3)	EBI-24478674	0.56
Q969G3	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (BRG1-associated factor 57) (BAF57)	EBI-24492471	0.56
Q2TBE0	CWF19-like protein 2	EBI-24508217	0.56
O14964	Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)	EBI-24370108	0.56
Q8TAB5	UPF0500 protein C1orf216	EBI-24382819	0.56
O43482	Protein Mis18-beta (Cancer/testis antigen 86) (CT86) (Opa-interacting protein 5) (OIP-5)	EBI-24385225	0.56
Q14119	Vascular endothelial zinc finger 1 (Putative transcription factor DB1) (Zinc finger protein 161)	EBI-24388342	0.56
Q2TBA0	Kelch-like protein 40 (Kelch repeat and BTB domain-containing protein 5) (Sarcosynapsin)	EBI-24398616	0.56
Q99633	Pre-mRNA-splicing factor 18 (PRP18 homolog) (hPRP18)	EBI-24401399	0.56
Q5W5X9	Tetratricopeptide repeat protein 23 (TPR repeat protein 23) (Cervical cancer proto-oncogene 8 protein) (HCC-8)	EBI-25260730	0.56
Q9ULD5	Zinc finger protein 777	EBI-24422254	0.56
Q6ZNE5	Beclin 1-associated autophagy-related key regulator (Barkor) (Autophagy-related protein 14-like protein) (Atg14L)	EBI-24423012	0.56
Q9Y2P0	Zinc finger protein 835	EBI-24424287	0.56
O60941	Dystrobrevin beta (DTN-B) (Beta-dystrobrevin)	EBI-24426448	0.56
O95363	Phenylalanine--tRNA ligase, mitochondrial (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase) (PheRS)	EBI-24427910	0.56
Q96PV4	Paraneoplastic antigen-like protein 5 (Tumor antigen BJ-HCC-25)	EBI-24432894	0.56
Q9BQ89	Protein FAM110A	EBI-24438032	0.56
P36508	Zinc finger protein 76 (Zinc finger protein 523)	EBI-24445889	0.56
P53365	Arfaptin-2 (ADP-ribosylation factor-interacting protein 2) (Partner of RAC1) (POR1)	EBI-24447892	0.56
Q8IYE0	Coiled-coil domain-containing protein 146	EBI-24463350	0.56
Q9UJV3	Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1)	EBI-24468925	0.56
Q9Y247	Protein FAM50B (Protein XAP-5-like)	EBI-24470709	0.56
P46013	Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67)	EBI-20562326	0.35
Q9Y394	Dehydrogenase/reductase SDR family member 7 (EC 1.1.1.-) (Retinal short-chain dehydrogenase/reductase 4) (retSDR4) (Short chain dehydrogenase/reductase family 34C member 1) (Protein SDR34C1)	EBI-20903160	0.40
P40426	Pre-B-cell leukemia transcription factor 3 (Homeobox protein PBX3)	EBI-22133174	0.37

Cross-References

Database	Links
UNIPROT	A1L4K1 B3KVG1 B7ZM02
Pfam	PF00041 PF00622
PROSITE	PS50188 PS50853
DisGeNET	123722

Fibronectin type III and SPRY domain-containing protein 2 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (93 interactors)

Cross-References

Database

Links

Description

Description