NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

C-Jun-amino-terminal kinase-interacting protein 3 - Rattus norvegicus - NucEnvDB

C-Jun-amino-terminal kinase-interacting protein 3 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	C-Jun-amino-terminal kinase-interacting protein 3
Accession Code	E9PSK7
Gene	Mapk8ip3
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 1322)
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYE FQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGGGQTESSLPGRSRKERPTSLNVFPLADGMVRAQMGGKLVPAGDHWHLSDLGQLQSSSSYQCPNDEMSESGQ SSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYGSVTKNNKRAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTA GSEVIGDVDEGADLLGEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDDKIPMAQRRRFTRVEMARVLME RNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTTAGFSQRRNHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQAC GWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAAGVNLSGWKPNEEDSSNGPKPAPGRDPLTCDREGEGEPKSTHPSPEKKKAKEVPEADATSSRVWILTSTLTTSKVVIIDANQPG TVVDQFTVCNAHVLCISSIPAASDSDYPPGDMFLDSDVNPEDSGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGDVAATANGKVNPSQSTEEATEATEVPDPGPSESEATTVRPGPLTEHVF TDPAPTQSSSTQPASENGSESDGSIVQPQVEPSGESSATTSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAV VDDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLG LRANKTSPTSGEGTRPGGIIHVYGDDSSDKTASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADAEGQKLKNALVLSGGEGYIDFRIGDGEDDETEEGTGDVNQT KPSLSKAERSHIIVWQVSYTPE

Subcellular Location

Description
Cytoplasm {By SimilarityUniProtKB:Q9ESN9}. Golgi apparatus {By SimilarityUniProtKB:Q9ESN9}. Cytoplasmic vesicle {By SimilarityUniProtKB:Q9ESN9}. Cell projection, growth cone {By SimilarityUniProtKB:Q9ESN9}. Cell projection, axon {ECO:0000269\|PubMed:21775604, ECO:0000269\|PubMed:23576431}. Cell projection, dendrite {ECO:0000269\|PubMed:21775604}. Cytoplasm, perinuclear region {ECO:0000269\|PubMed:21775604}. Note=Localized in the soma and growth cones of differentiated neurites and the Golgi and vesicles of the early secretory compartment of epithelial cells. KIF5A/B/C-mediated transportation to axon tips is essential for its function in enhancing neuronal axon elongation. {By SimilarityUniProtKB:Q9ESN9, ECO:0000269\|PubMed:23576431}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axolemma (GO:0030673) Axon (GO:0030424) Axon Cytoplasm (GO:1904115) Cell Body (GO:0044297) Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Dendrite (GO:0030425) Golgi Membrane (GO:0000139) Growth Cone (GO:0030426) Neuron Projection (GO:0043005) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Smooth Endoplasmic Reticulum (GO:0005790)

Biology & Function

Description
The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins (By similarity). Promotes neuronal axon elongation in a kinesin- and JNK-dependent manner. Activates cofilin at axon tips via local activation of JNK, thereby regulating filopodial dynamics and enhancing axon elongation. Its binding to kinesin heavy chains (KHC), promotes kinesin-1 motility along microtubules and is essential for axon elongation and regeneration. Regulates cortical neuronal migration by mediating NTRK2/TRKB anterograde axonal transport during brain development. Acts as an adapter that bridges the interaction between NTRK2/TRKB and KLC1 and drives NTRK2/TRKB axonal but not dendritic anterograde transport, which is essential for subsequent BDNF-triggered signaling and filopodia formation. {By SimilarityUniProtKB:Q9ESN9, Experimental EvidencePubMed:21076496, Experimental EvidencePubMed:21775604, Experimental EvidencePubMed:23576431, Experimental EvidencePubMed:25944905}.
Assigned Ontology terms

Biological Process	Anterograde Axonal Protein Transport (GO:0099641) Axon Development (GO:0061564) Axon Guidance (GO:0007411) Axon Regeneration (GO:0031103) Forebrain Development (GO:0030900) In Utero Embryonic Development (GO:0001701) JNK Cascade (GO:0007254) Lung Alveolus Development (GO:0048286) Lung Morphogenesis (GO:0060425) Negative Regulation Of Apoptotic Process (GO:0043066) Neuron Projection Development (GO:0031175) Positive Regulation Of JNK Cascade (GO:0046330) Positive Regulation Of JUN Kinase Activity (GO:0043507) Positive Regulation Of Neuron Differentiation (GO:0045666) Positive Regulation Of Neuron Migration (GO:2001224) Post-Embryonic Development (GO:0009791) Protein Localization (GO:0008104) Protein Stabilization (GO:0050821) Regulation Of Gene Expression (GO:0010468) Regulation Of JNK Cascade (GO:0046328) Respiratory Gaseous Exchange By Respiratory System (GO:0007585) Vesicle-Mediated Transport (GO:0016192)
Molecular Function	JUN Kinase Binding (GO:0008432) Kinesin Binding (GO:0019894) MAP-Kinase Scaffold Activity (GO:0005078) Mitogen-Activated Protein Kinase Kinase Binding (GO:0031434) Mitogen-Activated Protein Kinase Kinase Kinase Binding (GO:0031435) Signaling Receptor Complex Adaptor Activity (GO:0030159)

Cross-References

Database	Links
UNIPROT	E9PSK7 B0VXR4
Pfam	PF16471 PF09744
PROSITE	PS51776 PS51777

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK