Prostaglandin E synthase - Homo sapiens

Prostaglandin E synthase (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Prostaglandin E synthase
Accession Code	O14684
Gene	PTGES
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 152)
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIY PFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Structure Viewer (PDB: 4AL0)

Subcellular Location

Description
Membrane {Experimental EvidencePubMed:10377395, Experimental EvidencePubMed:16439136, Experimental EvidencePubMed:18682561, Experimental EvidencePubMed:27684486}; Multi-pass membrane protein {Curator InferencePubMed:18682561}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:10869354}. Note=Colocalizes with PTGS1/COX-1 and PTGS2/COX-2 in the perinuclear compartment. {Experimental EvidencePubMed:10869354}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Curator Inference {ECO:0000305\|PubMed:23431194}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum Membrane (GO:0005789) Membrane (GO:0016020) Nuclear Envelope Lumen (GO:0005641) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Terminal enzyme of the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. Catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli (PubMed:18682561, PubMed:10377395, PubMed:12672824, PubMed:12460774, PubMed:10869354, PubMed:12244105). Plays a key role in inflammation response, fever and pain (By similarity). Catalyzes also the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15-hydroperoxy-PGE2 (PubMed:12244105, PubMed:12672824). In addition, displays low glutathione transferase and glutathione- dependent peroxidase activities, toward 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively (PubMed:12672824). {By SimilarityUniProtKB:Q9JM51, Experimental EvidencePubMed:10377395, Experimental EvidencePubMed:10869354, Experimental EvidencePubMed:12244105, Experimental EvidencePubMed:12460774, Experimental EvidencePubMed:12672824, Experimental EvidencePubMed:18682561}.
Assigned Ontology terms

Biological Process	Cell Population Proliferation (GO:0008283) Negative Regulation Of Cell Population Proliferation (GO:0008285) Positive Regulation Of Prostaglandin Secretion (GO:0032308) Prostaglandin Biosynthetic Process (GO:0001516) Prostaglandin Metabolic Process (GO:0006693) Regulation Of Fever Generation (GO:0031620) Regulation Of Inflammatory Response (GO:0050727) Sensory Perception Of Pain (GO:0019233) Signal Transduction (GO:0007165)
Molecular Function	Glutathione Binding (GO:0043295) Glutathione Peroxidase Activity (GO:0004602) Glutathione Transferase Activity (GO:0004364) Prostaglandin-D Synthase Activity (GO:0004667) Prostaglandin-E Synthase Activity (GO:0050220)

Protein-Protein Interactions

Interactions with other proteins (19 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9Y3E0	Vesicle transport protein GOT1B (Germ cell tumor 2) (Golgi transport 1 homolog B) (Putative NF-kappa-B-activating protein 470) (hGOT1a)	EBI-11161387	0.35
Q9H0R3	Transmembrane protein 222	EBI-24674609	0.56
Q04941	Proteolipid protein 2 (Differentiation-dependent protein A4) (Intestinal membrane A4 protein)	EBI-24686270	0.56
Q9NRQ5	Single-pass membrane and coiled-coil domain-containing protein 4 (Protein FN5)	EBI-23722140	0.56
Q96IW7	Vesicle-trafficking protein SEC22a (SEC22 vesicle-trafficking protein homolog A) (SEC22 vesicle-trafficking protein-like 2)	EBI-23723397	0.56
Q6PI78	Transmembrane protein 65	EBI-24690855	0.56
Q96F15	GTPase IMAP family member 5 (Immune-associated nucleotide-binding protein 5) (Immunity-associated nucleotide 4-like 1 protein) (Immunity-associated nucleotide 5 protein) (IAN-5) (hIAN5) (Immunity-associated protein 3)	EBI-23780523	0.56
Q8N6R1	Stress-associated endoplasmic reticulum protein 2 (Ribosome-associated membrane protein RAMP4-2)	EBI-23798787	0.56
O95070	Protein YIF1A (54TMp) (YIP1-interacting factor homolog A)	EBI-23825176	0.56
Q08426	Peroxisomal bifunctional enzyme (PBE) (PBFE) (L-bifunctional protein) (LBP) (Multifunctional enzyme 1) (MFE1) [Includes: Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase (EC 4.2.1.17) (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)]	EBI-24755804	0.56
O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	EBI-24784464	0.56
Q8WWP7	GTPase IMAP family member 1 (Immunity-associated protein 1) (hIMAP1)	EBI-24641110	0.56
O15155	BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18)	EBI-24644551	0.56
O75379	Vesicle-associated membrane protein 4 (VAMP-4)	EBI-24799716	0.56
Q96HH6	Transmembrane protein 19	EBI-25213278	0.56
Q15836	Vesicle-associated membrane protein 3 (VAMP-3) (Cellubrevin) (CEB) (Synaptobrevin-3)	EBI-25224808	0.56
Q8WVX3	Uncharacterized protein C4orf3 (Hepatitis C virus F protein-transactivated protein 1) (HCV F-transactivated protein 1)	EBI-25273998	0.56
P19739	Non-structural protein 4a (ns4a) (Accessory protein 4a)	EBI-25685423	0.35
P0DTD8	ORF7b protein (ORF7b) (Accessory protein 7b)	EBI-25687199	0.35

Cross-References

Database	Links
UNIPROT	O14684 O14900 Q5SZC0
PDB	3DWW 4AL0 4AL1 4BPM 4WAB 4YK5 4YL0 4YL1 4YL3 5BQG 5BQH 5BQI 5K0I 5T36 5T37 5TL9 6VL4
Pfam	PF01124
OMIM	605172
DisGeNET	9536

NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Prostaglandin E synthase (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 4AL0)

Subcellular Location

Description

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (19 interactors)

Cross-References

Database

Links

Prostaglandin E synthase (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 4AL0)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (19 interactors)

Cross-References

Database

Links

Description

Description