Protein Information |
|
|---|---|
| Protein Name | Membrane-associated progesterone receptor component 2 |
| Accession Code | O15173 |
| Gene | PGRMC2 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 223) | |
|
MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDV TKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD |
|
Description |
||
|---|---|---|
| Membrane {Curator InferencePubMed:23793472}; Single- pass membrane protein {Curator Inference}. Nucleus envelope {Experimental EvidencePubMed:27754849, Experimental EvidencePubMed:28111073}. Endoplasmic reticulum {Experimental EvidencePubMed:27754849}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
| Cellular Component | Endomembrane System (GO:0012505) Endoplasmic Reticulum (GO:0005783) Membrane (GO:0016020) Nuclear Envelope (GO:0005635) |
|
Description |
|
|---|---|
| Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan (By similarity). May serve as a universal non-classical progesterone receptor in the uterus (Probable). Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus (By similarity). Plays a role in adipocyte function and systemic glucose homeostasis (PubMed:28111073). In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1 (By similarity). {By SimilarityUniProtKB:Q80UU9, Experimental EvidencePubMed:28111073, Curator InferencePubMed:28396637}. | Assigned Ontology terms |
| Biological Process | Adipose Tissue Development (GO:0060612) |
| Molecular Function | Heme Binding (GO:0020037) Heme Transmembrane Transporter Activity (GO:0015232) Nuclear Steroid Receptor Activity (GO:0003707) Steroid Binding (GO:0005496) |
Interactions with Nuclear Envelope proteins (11 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A0A142I5B9 | RNA-directed RNA polymerase NS5 | EBI-20626314 | 0.35 |
| Q9WMX2 | RNA-directed RNA polymerase | EBI-11513489 | 0.35 |
| Q9P0L0 | Vesicle-associated membrane protein-associated protein A | EBI-24691023 | 0.56 |
| Q80UU9 | Membrane-associated progesterone receptor component 2 | EBI-12523269 | 0.35 |
| Q9BVC6 | Transmembrane protein 109 | EBI-20900351 | 0.40 |
| Q925D4 | Transmembrane protein 176B | EBI-22259161 | 0.35 |
| O95476 | CTD nuclear envelope phosphatase 1 | EBI-27115722 | 0.27 |
| P03246 | E1B protein, small T-antigen | EBI-11722343 | 0.35 |
| O14681 | Etoposide-induced protein 2.4 homolog | EBI-24712104 | 0.56 |
| Q8IWB1 | Inositol 1,4,5-trisphosphate receptor-interacting protein | EBI-23781080 | 0.56 |
| P02545 | Lamin-A/C | EBI-16795756 | 0.27 | Interactions with other proteins (142 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q14164 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i) | EBI-1083472 | 0.00 |
| P0DOE9 | Non-structural protein 1 (NS1) (Non-structural protein 1C) | EBI-6138583 | 0.35 |
| Q77M19 | V protein | EBI-6270503 | 0.35 |
| P03182 | Apoptosis regulator BHRF1 (Early antigen protein R) (EA-R) (Nuclear antigen) | EBI-11721938 | 0.35 |
| P06460 | Probable protein E5A | EBI-11723082 | 0.35 |
| P06461 | Probable protein E5B | EBI-11723785 | 0.35 |
| P06792 | Probable protein E5 | EBI-11724527 | 0.35 |
| P06927 | Probable protein E5 | EBI-11724813 | 0.35 |
| P0CK49 | Tegument protein UL51 homolog | EBI-11725356 | 0.35 |
| P0C739 | Protein BNLF2a | EBI-11725101 | 0.35 |
| P0CK56 | Uncharacterized protein BDLF4 | EBI-11725466 | 0.35 |
| P0CK58 | Apoptosis regulator BALF1 | EBI-11732874 | 0.35 |
| P69901 | Probable protein E5B | EBI-11733364 | 0.35 |
| Q2MG95 | BVLF1 | EBI-11733653 | 0.35 |
| Q5HYA8 | Meckelin (Meckel syndrome type 3 protein) (Transmembrane protein 67) | EBI-11367583 | 0.27 |
| Q6NUS6 | Tectonic-3 | EBI-11368748 | 0.27 |
| Q86UK5 | Limbin (Ellis-van Creveld syndrome protein 2) (EVC2) | EBI-11372136 | 0.27 |
| Q86X19 | Transmembrane protein 17 | EBI-11372615 | 0.27 |
| Q96GX1 | Tectonic-2 | EBI-11375285 | 0.27 |
| Q9P0N5 | Transmembrane protein 216 | EBI-11378021 | 0.27 |
| Q9NWU2 | Glucose-induced degradation protein 8 homolog (Two hybrid-associated protein 1 with RanBPM) (Twa1) | EBI-12450239 | 0.51 |
| Q96G75 | E3 ubiquitin-protein transferase RMND5B (EC 2.3.2.27) (Protein RMD5 homolog B) | EBI-12452053 | 0.51 |
| O95429 | BAG family molecular chaperone regulator 4 (BAG-4) (Bcl-2-associated athanogene 4) (Silencer of death domains) | EBI-24341628 | 0.56 |
| Q6UX40 | Transmembrane protein 107 | EBI-24668603 | 0.56 |
| Q01453 | Peripheral myelin protein 22 (PMP-22) (Growth arrest-specific protein 3) (GAS-3) | EBI-24674117 | 0.56 |
| Q8N5I4 | Dehydrogenase/reductase SDR family member on chromosome X (EC 1.1.-.-) (DHRSXY) (Short chain dehydrogenase/reductase family 46C member 1) (Short chain dehydrogenase/reductase family 7C member 6) | EBI-24674227 | 0.56 |
| O60906 | Sphingomyelin phosphodiesterase 2 (EC 3.1.4.12) (Lyso-platelet-activating factor-phospholipase C) (Lyso-PAF-PLC) (Neutral sphingomyelinase) (N-SMase) (nSMase) (nSMase1) | EBI-24683333 | 0.56 |
| Q14656 | Transmembrane protein 187 (Protein ITBA1) | EBI-24687401 | 0.56 |
| P01031 | Complement C5 (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4) [Cleaved into: Complement C5 beta chain; Complement C5 alpha chain; C5a anaphylatoxin; Complement C5 alpha' chain] | EBI-24694240 | 0.56 |
| Q13021 | MAL-like protein (Protein BENE) | EBI-24695750 | 0.56 |
| Q8IVQ6 | Palmitoyltransferase ZDHHC21 (EC 2.3.1.225) (DHHC domain-containing cysteine-rich protein 21) (DHHC-21) (Zinc finger DHHC domain-containing protein 21) | EBI-24706532 | 0.56 |
| P59542 | Taste receptor type 2 member 19 (Taste receptor type 2 member 23) (Taste receptor type 2 member 48) (T2R48) | EBI-24708148 | 0.56 |
| Q7RTY0 | Monocarboxylate transporter 13 (MCT 13) (Solute carrier family 16 member 13) | EBI-24708883 | 0.56 |
| Q9NZ01 | Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER) | EBI-24711415 | 0.56 |
| O43681 | ATPase GET3 (EC 3.6.-.-) (Arsenical pump-driving ATPase) (Arsenite-stimulated ATPase) (Guided entry of tail-anchored proteins factor 3, ATPase) (Transmembrane domain recognition complex 40 kDa ATPase subunit) (hARSA-I) (hASNA-I) | EBI-24715630 | 0.56 |
| Q86UD5 | Sodium/hydrogen exchanger 9B2 (Na(+)/H(+) exchanger NHA2) (Na(+)/H(+) exchanger-like domain-containing protein 2) (NHE domain-containing protein 2) (Sodium/hydrogen exchanger-like domain-containing protein 2) (Solute carrier family 9 subfamily B member 2) | EBI-24720671 | 0.56 |
| Q8IWU4 | Zinc transporter 8 (ZnT-8) (Solute carrier family 30 member 8) | EBI-24722592 | 0.56 |
| O14569 | Transmembrane reductase CYB561D2 (EC 7.2.1.3) (Cytochrome b561 domain-containing protein 2) (Putative tumor suppressor protein 101F6) | EBI-24726780 | 0.56 |
| Q5RI15 | Cytochrome c oxidase assembly protein COX20, mitochondrial | EBI-24727330 | 0.56 |
| O00264 | Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA) | EBI-24738362 | 0.56 |
| O76064 | E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8) | EBI-23831845 | 0.56 |
| Q9Y5Y5 | Peroxisomal membrane protein PEX16 (Peroxin-16) (Peroxisomal biogenesis factor 16) | EBI-23837903 | 0.56 |
| Q9H2H9 | Sodium-coupled neutral amino acid symporter 1 (Amino acid transporter A1) (N-system amino acid transporter 2) (Solute carrier family 38 member 1) (System A amino acid transporter 1) (System N amino acid transporter 1) | EBI-24767413 | 0.56 |
| Q9H2L4 | Transmembrane protein 60 | EBI-24768625 | 0.56 |
| O95159 | Zinc finger protein-like 1 (Zinc finger protein MCG4) | EBI-24772852 | 0.56 |
| O60636 | Tetraspanin-2 (Tspan-2) (Tetraspan NET-3) | EBI-24779563 | 0.56 |
| P11215 | Integrin alpha-M (CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b) | EBI-24786003 | 0.56 |
| Q9UBY5 | Lysophosphatidic acid receptor 3 (LPA receptor 3) (LPA-3) (Lysophosphatidic acid receptor Edg-7) | EBI-24793347 | 0.56 |
| Q9BWQ6 | Protein YIPF2 (YIP1 family member 2) | EBI-24796209 | 0.56 |
| P02787 | Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin) | EBI-24797200 | 0.56 |
| Q9H3K2 | Growth hormone-inducible transmembrane protein (Dermal papilla-derived protein 2) (Mitochondrial morphology and cristae structure 1) (MICS1) (Transmembrane BAX inhibitor motif-containing protein 5) | EBI-24797448 | 0.56 |
| P78329 | Cytochrome P450 4F2 (EC 1.14.14.1) (20-hydroxyeicosatetraenoic acid synthase) (20-HETE synthase) (Arachidonic acid omega-hydroxylase) (CYPIVF2) (Cytochrome P450-LTB-omega) (Docosahexaenoic acid omega-hydroxylase) (EC 1.14.14.79) (Leukotriene-B(4) 20-monooxygenase 1) (Leukotriene-B(4) omega-hydroxylase 1) (EC 1.14.14.94) (Phylloquinone omega-hydroxylase CYP4F2) (EC 1.14.14.78) | EBI-24798035 | 0.56 |
| Q96H72 | Zinc transporter ZIP13 (LIV-1 subfamily of ZIP zinc transporter 9) (LZT-Hs9) (Solute carrier family 39 member 13) (Zrt- and Irt-like protein 13) (ZIP-13) | EBI-25284904 | 0.56 |
| Q96JF0 | Beta-galactoside alpha-2,6-sialyltransferase 2 (Alpha 2,6-ST 2) (EC 2.4.3.1) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2) (ST6Gal II) (ST6GalII) (hST6Gal II) (Sialyltransferase 2) | EBI-25286104 | 0.56 |
| Q96PS8 | Aquaporin-10 (AQP-10) (Aquaglyceroporin-10) (Small intestine aquaporin) | EBI-24548121 | 0.56 |
| Q7L5A8 | Fatty acid 2-hydroxylase (EC 1.14.18.-) (Fatty acid alpha-hydroxylase) (Fatty acid hydroxylase domain-containing protein 1) | EBI-25146219 | 0.56 |
| Q9H9B4 | Sideroflexin-1 | EBI-24642361 | 0.56 |
| Q13277 | Syntaxin-3 | EBI-25147430 | 0.56 |
| Q96GQ5 | RUS family member 1 | EBI-24650336 | 0.56 |
| Q8N2M4 | Lysoplasmalogenase-like protein TMEM86A (Transmembrane protein 86A) | EBI-24655777 | 0.56 |
| I3L0A0 | HCG2044781 (PEDS1-UBE2V1 readthrough) | EBI-24658689 | 0.56 |
| Q9H0Q3 | FXYD domain-containing ion transport regulator 6 (Phosphohippolin) | EBI-24746517 | 0.56 |
| Q96HH6 | Transmembrane protein 19 | EBI-25185187 | 0.56 |
| Q96IV6 | Fatty acid hydroxylase domain-containing protein 2 | EBI-24774155 | 0.56 |
| O00124 | UBX domain-containing protein 8 (Reproduction 8 protein) (Rep-8 protein) (UBX domain-containing protein 6) | EBI-25192578 | 0.56 |
| A0A024RCD1 | NAD(P)(+)--arginine ADP-ribosyltransferase (EC 2.4.2.31) (Mono(ADP-ribosyl)transferase) | EBI-24790520 | 0.56 |
| Q9Y342 | Plasmolipin (Plasma membrane proteolipid) | EBI-24803718 | 0.56 |
| Q9BTX3 | Transmembrane protein 208 | EBI-24803996 | 0.56 |
| Q9P0S3 | ORM1-like protein 1 (Adoplin-1) | EBI-24804382 | 0.56 |
| Q6ZPD8 | Diacylglycerol O-acyltransferase 2-like protein 6 (EC 2.3.1.-) (Diacylglycerol O-acyltransferase candidate 3) (hDC3) | EBI-24804564 | 0.56 |
| Q8N661 | Lysoplasmalogenase (EC 3.3.2.2) (Transmembrane protein 86B) | EBI-25218050 | 0.56 |
| Q6N075 | Molybdate-anion transporter (Major facilitator superfamily domain-containing protein 5) (Molybdate transporter 2 homolog) (hsMOT2) | EBI-24807339 | 0.56 |
| Q8TDV0 | G-protein coupled receptor 151 (G-protein coupled receptor PGR7) (GPCR-2037) (Galanin receptor 4) (Galanin-receptor-like protein) (GalRL) | EBI-25267216 | 0.56 |
| P22315 | Ferrochelatase, mitochondrial (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | EBI-12523269 | 0.50 |
| Q78IK4 | MICOS complex subunit Mic27 (Apolipoprotein O-like) (Protein FAM121A) | EBI-12523269 | 0.35 |
| Q8CI59 | Metalloreductase STEAP3 (EC 1.16.1.-) (Dudulin-2) (Protein nm1054) (Six-transmembrane epithelial antigen of prostate 3) (Tumor suppressor-activated pathway protein 6) | EBI-12523269 | 0.35 |
| Q62351 | Transferrin receptor protein 1 (TR) (TfR) (TfR1) (Trfr) (CD antigen CD71) | EBI-12523269 | 0.35 |
| Q9CR62 | Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11) | EBI-12523269 | 0.35 |
| Q60930 | Voltage-dependent anion-selective channel protein 2 (VDAC-2) (mVDAC2) (Outer mitochondrial membrane protein porin 2) (Voltage-dependent anion-selective channel protein 6) (VDAC-6) (mVDAC6) | EBI-12523269 | 0.35 |
| P51881 | ADP/ATP translocase 2 (ADP,ATP carrier protein 2) (Adenine nucleotide translocator 2) (ANT 2) (Solute carrier family 25 member 5) [Cleaved into: ADP/ATP translocase 2, N-terminally processed] | EBI-12523269 | 0.35 |
| P48962 | ADP/ATP translocase 1 (ADP,ATP carrier protein 1) (ADP,ATP carrier protein, heart/skeletal muscle isoform T1) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4) | EBI-12523269 | 0.35 |
| Q61102 | Iron-sulfur clusters transporter ABCB7, mitochondrial (ATP-binding cassette sub-family B member 7, mitochondrial) (ATP-binding cassette transporter 7) (ABC transporter 7 protein) | EBI-12523269 | 0.35 |
| Q9JI39 | ATP-binding cassette sub-family B member 10, mitochondrial (ABC-mitochondrial erythroid protein) (ABC-me protein) (ATP-binding cassette transporter 10) (ABC transporter 10 protein) | EBI-12523269 | 0.35 |
| Q9Z2I9 | Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial (EC 6.2.1.5) (ATP-specific succinyl-CoA synthetase subunit beta) (A-SCS) (Succinyl-CoA synthetase beta-A chain) (SCS-betaA) | EBI-12523269 | 0.35 |
| P08680 | 5-aminolevulinate synthase, erythroid-specific, mitochondrial (ALAS-E) (EC 2.3.1.37) (5-aminolevulinic acid synthase 2) (Delta-ALA synthase 2) (Delta-aminolevulinate synthase 2) | EBI-12523269 | 0.35 |
| P58281 | Dynamin-like 120 kDa protein, mitochondrial (EC 3.6.5.5) (Large GTP-binding protein) (LargeG) (Optic atrophy protein 1 homolog) [Cleaved into: Dynamin-like 120 kDa protein, form S1] | EBI-12523269 | 0.35 |
| Q8CAQ8 | MICOS complex subunit Mic60 (Mitochondrial inner membrane protein) (Mitofilin) | EBI-12523269 | 0.35 |
| O55022 | Membrane-associated progesterone receptor component 1 (mPR) | EBI-12523269 | 0.35 |
| Q8IWL3 | Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial] | EBI-13943458 | 0.35 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-16788621 | 0.42 |
| Q96I36 | Cytochrome c oxidase assembly protein COX14 | EBI-16791250 | 0.27 |
| P11279 | Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) | EBI-16794808 | 0.27 |
| Q9HBL7 | Plasminogen receptor (KT) (Plg-R(KT)) | EBI-16797780 | 0.27 |
| O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.27 |
| Q9Y4C4 | Malignant fibrous histiocytoma-amplified sequence 1 (Malignant fibrous histiocytoma-amplified sequence with leucine-rich tandem repeats 1) | EBI-20589710 | 0.44 |
| Q83DF6 | Putative ankyrin repeat protein CBU_0781 | EBI-21285326 | 0.37 |
| P05154 | Plasma serine protease inhibitor (Acrosomal serine protease inhibitor) (Plasminogen activator inhibitor 3) (PAI-3) (PAI3) (Protein C inhibitor) (PCI) (Serpin A5) | EBI-20911464 | 0.40 |
| P04233 | HLA class II histocompatibility antigen gamma chain (HLA-DR antigens-associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide (CLIP)] | EBI-21258980 | 0.35 |
| Q15077 | P2Y purinoceptor 6 (P2Y6) | EBI-21262943 | 0.35 |
| Q96GC9 | Vacuole membrane protein 1 (Transmembrane protein 49) | EBI-21267986 | 0.35 |
| M0R671 | Tensin 2 | EBI-22259161 | 0.35 |
| F1LML3 | Aldo-keto reductase family 1 member D1 | EBI-22259161 | 0.35 |
| F1LM93 | Tyrosine-protein kinase Yes (EC 2.7.10.2) (p61-Yes) | EBI-22259161 | 0.35 |
| A0A0G2K261 | Isoleucine--tRNA ligase (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) | EBI-22259161 | 0.35 |
| Q5U2U8 | BAG cochaperone 3 (Bcl2-associated athanogene 3) (RCG40209, isoform CRA_b) | EBI-22259161 | 0.35 |
| Q5RKH1 | Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1) (PRP4 pre-mRNA-processing factor 4 homolog) | EBI-22259161 | 0.35 |
| D4A1H9 | Cytochrome P450, family 4, subfamily f, polypeptide 39 | EBI-22259161 | 0.35 |
| D4A7J8 | PRP4 pre-mRNA processing factor 4 homolog (Yeast) (Pre-mRNA-processing factor 4) | EBI-22259161 | 0.35 |
| P42346 | Serine/threonine-protein kinase mTOR (EC 2.7.11.1) (FK506-binding protein 12-rapamycin complex-associated protein 1) (FKBP12-rapamycin complex-associated protein) (Mammalian target of rapamycin) (mTOR) (Mechanistic target of rapamycin) (Rapamycin target protein 1) (RAPT1) | EBI-22259161 | 0.35 |
| A0A0G2K781 | PPFIA-binding protein 1 | EBI-22259161 | 0.35 |
| P00176 | Cytochrome P450 2B1 (EC 1.14.14.1) (CYPIIB1) (Cytochrome P450-B) (Cytochrome P450b) (Cytochrome P450-LM2) (Cytochrome P450-PB1) (Cytochrome P450-PB2) | EBI-22259161 | 0.35 |
| O08662 | Phosphatidylinositol 4-kinase alpha (PI4-kinase alpha) (PI4K-alpha) (PtdIns-4-kinase alpha) (EC 2.7.1.67) | EBI-22259161 | 0.35 |
| Q5PQL2 | CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1) | EBI-22259161 | 0.35 |
| D3ZYG0 | Vav guanine nucleotide exchange factor 2 | EBI-22259161 | 0.35 |
| D3ZGM1 | Pentatricopeptide repeat domain 3 | EBI-22259161 | 0.35 |
| Q8K4V4 | Sorting nexin-27 (MAP-responsive gene protein) (Methamphetamine-responsive transcript 1 protein) (PDZ-protein Mrt1) | EBI-22259161 | 0.35 |
| Q5RKH0 | Cytokine-like nuclear factor N-PAC (NPAC) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Putative oxidoreductase GLYR1) | EBI-22259161 | 0.35 |
| D4A104 | Mitochondrial ribosomal protein L45 (Mitochondrial ribosomal protein L45 (Predicted)) | EBI-22259161 | 0.35 |
| Q9BY14 | Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein) | EBI-25505061 | 0.35 |
| Q9BUN8 | Derlin-1 (Degradation in endoplasmic reticulum protein 1) (DERtrin-1) (Der1-like protein 1) | EBI-25770511 | 0.35 |
| Q9IH62 | Glycoprotein G | EBI-25750665 | 0.35 |
| P34972 | Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5) | EBI-26880846 | 0.35 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| A0A0H3NFP4 | SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity) | EBI-27055788 | 0.27 |
| A0A0H3NG92 | Type III secretion system effector protein-regulates and maintains the SCV (Type III secretion systems effector SseF) | EBI-27055968 | 0.27 |
| A0A0H3NF08 | SPI-2 type III secretion system effector PipB2 (Type III secretion system effector protein, Contributes to Sif formation) | EBI-27055973 | 0.27 |
| A0A0H3NB75 | Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV) | EBI-27055983 | 0.27 |
| Q8NI60 | Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3) | EBI-28943519 | 0.35 |
| Q9H5K3 | Protein O-mannose kinase (POMK) (EC 2.7.1.183) (Protein kinase-like protein SgK196) (Sugen kinase 196) | EBI-28948637 | 0.35 |
| Q9ULR3 | Protein phosphatase 1H (EC 3.1.3.16) | EBI-27116214 | 0.27 |
| Q9UM73 | ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246) | EBI-32719830 | 0.27 |
| P29322 | Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK) | EBI-32721175 | 0.27 |
| P11362 | Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) | EBI-32721578 | 0.27 |
| P22607 | Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333) | EBI-32721979 | 0.27 |
| P22455 | Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334) | EBI-32722168 | 0.27 |
| P35916 | Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4) | EBI-32722728 | 0.27 |
| P08069 | Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] | EBI-32722947 | 0.27 |
| P06213 | Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta] | EBI-32723092 | 0.27 |
| Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32724526 | 0.27 |
| P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-32725031 | 0.27 |
| Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2) | EBI-32725367 | 0.27 |
| Q6J9G0 | Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1) | EBI-32731895 | 0.27 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory