HCLS1-associated protein X-1 - Mus musculus

HCLS1-associated protein X-1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	HCLS1-associated protein X-1
Accession Code	O35387
Gene	Hax1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 280)
MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDRGAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGERLREGQTLRDSM LKYPDSHQPRIFEGVLESHAKPESPKPAPDWGSQGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETTVTHQEAHDSSRSDPDSQRSS ALDDPFSILDLLLGRWFRSR

Subcellular Location

Description
Mitochondrion {Experimental EvidencePubMed:16814492}. Endoplasmic reticulum {Experimental EvidencePubMed:10760273}. Nucleus membrane {Curator InferencePubMed:16814492}. Cytoplasmic vesicle {Experimental EvidencePubMed:10760273, Experimental EvidencePubMed:16814492}. Cytoplasm, cell cortex {ECO:0000250\|UniProtKB:O00165}. Cell membrane {ECO:0000250\|UniProtKB:O00165}; Peripheral membrane protein {ECO:0000250\|UniProtKB:O00165}; Cytoplasmic side {ECO:0000250\|UniProtKB:O00165}. Sarcoplasmic reticulum {ECO:0000250\|UniProtKB:Q7TSE9}. Cytoplasm, P-body {ECO:0000250\|UniProtKB:O00165}. Cytoplasm {ECO:0000250\|UniProtKB:O00165}. Nucleus {ECO:0000250\|UniProtKB:O00165}. Note=Predominantly cytoplasmic. Also detected in the nucleus when nuclear export is inhibited (in vitro). {ECO:0000250\|UniProtKB:O00165}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:O00165}
Assigned Ontology terms

Cellular Component	Actin Cytoskeleton (GO:0015629) Apical Plasma Membrane (GO:0016324) Cell Cortex (GO:0005938) Clathrin-Coated Vesicle (GO:0030136) Cytoplasm (GO:0005737) Endoplasmic Reticulum (GO:0005783) Intracellular Membrane-Bounded Organelle (GO:0043231) Lamellipodium (GO:0030027) Mitochondrial Intermembrane Space (GO:0005758) Mitochondrial Outer Membrane (GO:0005741) Mitochondrion (GO:0005739) Nuclear Membrane (GO:0031965) P-Body (GO:0000932) Sarcoplasmic Reticulum (GO:0016529) Transcription Regulator Complex (GO:0005667)

Biology & Function

Description
Recruits the Arp2/3 complex to the cell cortex and regulates reorganization of the cortical actin cytoskeleton via its interaction with KCNC3 and the Arp2/3 complex. Slows down the rate of inactivation of KCNC3 channels. Promotes GNA13-mediated cell migration. Involved in the clathrin-mediated endocytosis pathway. May be involved in internalization of ABC transporters such as ABCB11. May inhibit CASP9 and CASP3. Promotes cell survival. May regulate intracellular calcium pools. {By SimilarityUniProtKB:O00165}.
Assigned Ontology terms

Biological Process	Cell Surface Receptor Signaling Pathway (GO:0007166) Cellular Response To Cytokine Stimulus (GO:0071345) Negative Regulation Of Apoptotic Process (GO:0043066) Positive Regulation Of Actin Cytoskeleton Reorganization (GO:2000251) Positive Regulation Of Granulocyte Differentiation (GO:0030854) Positive Regulation Of Peptidyl-Serine Phosphorylation (GO:0033138) Positive Regulation Of Peptidyl-Tyrosine Phosphorylation (GO:0050731) Positive Regulation Of Phosphatidylinositol 3-Kinase Signaling (GO:0014068) Positive Regulation Of Protein Kinase B Signaling (GO:0051897) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Regulation Of Actin Filament Polymerization (GO:0030833)
Molecular Function	Interleukin-1 Binding (GO:0019966) Protein Domain Specific Binding (GO:0019904) Protein N-Terminus Binding (GO:0047485)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P37198	Nuclear pore glycoprotein p62	EBI-11010276	0.35
Interactions with other proteins (21 interactors)

Partner (UniProt)		IntAct	Confidence score
P42227	Signal transducer and activator of transcription 3 (Acute-phase response factor)	EBI-657283	0.37
Q8BWG8	Beta-arrestin-1 (Arrestin beta-1)	EBI-649719	0.37
Q8CIH5	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 (EC 3.1.4.11) (Phosphoinositide phospholipase C-gamma-2) (Phospholipase C-gamma-2) (PLC-gamma-2)	EBI-649769	0.37
Q13563	Polycystin-2 (PC2) (Autosomal dominant polycystic kidney disease type II protein) (Polycystic kidney disease 2 protein) (Polycystwin) (R48321) (Transient receptor potential cation channel subfamily P member 2)	EBI-9635489	0.51
O14925	Mitochondrial import inner membrane translocase subunit Tim23	EBI-11010276	0.35
Q9H477	Ribokinase (RK) (EC 2.7.1.15)	EBI-11010276	0.35
H3BS42	Zinc finger protein 768	EBI-11010276	0.35
P56199	Integrin alpha-1 (CD49 antigen-like family member A) (Laminin and collagen receptor) (VLA-1) (CD antigen CD49a)	EBI-11010276	0.35
P10809	60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein)	EBI-11010276	0.35
Q92604	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Acyl-CoA:monoacylglycerol acyltransferase LPGAT1) (EC 2.3.1.22) (Lysophospholipid acyltransferase 7) (LPLAT7) (EC 2.3.1.-) (Stearoyl-CoA:1-lyso-2-acyl-PE acyltransferase)	EBI-11010276	0.35
P12236	ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed]	EBI-11010276	0.35
Q9H061	Transmembrane protein 126A	EBI-11010276	0.35
Q7KZ85	Transcription elongation factor SPT6 (hSPT6) (Histone chaperone suppressor of Ty6) (Tat-cotransactivator 2 protein) (Tat-CT2 protein)	EBI-11010276	0.35
O15066	Kinesin-like protein KIF3B (HH0048) (Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein KIF3B, N-terminally processed]	EBI-11010276	0.35
Q9H078	Caseinolytic peptidase B protein homolog (EC 3.6.1.-) (Suppressor of potassium transport defect 3)	EBI-11010276	0.35
O75165	DnaJ homolog subfamily C member 13 (Required for receptor-mediated endocytosis 8) (RME-8)	EBI-11010276	0.35
G3XAN4	Translocating chain-associated membrane protein 1 (Translocation associated membrane protein 1, isoform CRA_a)	EBI-11010276	0.35
B4E1G1	Derlin	EBI-11010276	0.35
Q5XJY4	Presenilins-associated rhomboid-like protein, mitochondrial (EC 3.4.21.105) (Mitochondrial intramembrane-cleaving protease PARL) [Cleaved into: P-beta (Pbeta)]	EBI-15687233	0.52
Q9JIY5	Serine protease HTRA2, mitochondrial (EC 3.4.21.108) (High temperature requirement protein A2) (HtrA2) (Omi stress-regulated endoprotease) (Serine protease 25) (Serine proteinase OMI)	EBI-15687275	0.52
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-26612017	0.35

Cross-References

Database	Links
UNIPROT	O35387 Q542F8

HCLS1-associated protein X-1 (Mus musculus)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (21 interactors)

Cross-References

Database

Links

Description

Description