NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Amyloid-beta A4 precursor protein-binding family A member 1 - Rattus norvegicus - NucEnvDB

Amyloid-beta A4 precursor protein-binding family A member 1 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Amyloid-beta A4 precursor protein-binding family A member 1
Accession Code	O35430
Gene	Apba1
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 839)
MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPPPPPPPQEEEEERGECLARSA STESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYAVQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEE AMNAAYSGYVYTHRLFHRAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYD ERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGGGHPDSPGLPAP AGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVD GDSPSPGSSSPLGAESSITPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPS KNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLM ARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQ DMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLP LSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVA TPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI

Structure Viewer (PDB: 6KMH)

Subcellular Location

Description
Cytoplasm {By Similarity}. Cytoplasm, perinuclear region {By Similarity}. Nucleus {ECO:0000269\|PubMed:20531236}. Note=Only a small proportion of the protein is nuclear. [Isoform 2]: Golgi apparatus {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dendritic Spine (GO:0043197) Glutamatergic Synapse (GO:0098978) Golgi Apparatus (GO:0005794) Membrane (GO:0016020) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Presynaptic Active Zone Membrane (GO:0048787) Protein-Containing Complex (GO:0032991) Schaffer Collateral - CA1 Synapse (GO:0098685) Synaptic Vesicle (GO:0008021)

Biology & Function

Description
Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the amyloid-beta precursor protein (APP) and hence formation of APP-beta.
Assigned Ontology terms

Biological Process	Chemical Synaptic Transmission (GO:0007268) Establishment Of Localization In Cell (GO:0051649) Gamma-Aminobutyric Acid Secretion (GO:0014051) Glutamate Secretion (GO:0014047) In Utero Embryonic Development (GO:0001701) Intracellular Protein Transport (GO:0006886) Locomotory Behavior (GO:0007626) Multicellular Organism Growth (GO:0035264) Protein-Containing Complex Assembly (GO:0065003) Regulation Of Gene Expression (GO:0010468) Regulation Of Synaptic Vesicle Exocytosis (GO:2000300) Synaptic Vesicle Exocytosis (GO:0016079)
Molecular Function	Amyloid-Beta Binding (GO:0001540) PDZ Domain Binding (GO:0030165) Phosphatidylinositol-4,5-Bisphosphate Binding (GO:0005546) Protein-Containing Complex Binding (GO:0044877)

Protein-Protein Interactions

Interactions with other proteins (14 interactors)

Partner (UniProt)		IntAct	Confidence score
P26010	Integrin beta-7 (Gut homing receptor beta subunit)	EBI-8611689	0.44
P05106	Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)	EBI-8611732	0.44
P05556	Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)	EBI-8611776	0.44
Q99PW8	Kinesin-like protein KIF17 (MmKIF17)	EBI-7293493	0.64
Q00975	Voltage-dependent N-type calcium channel subunit alpha-1B (Brain calcium channel III) (BIII) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Voltage-gated calcium channel subunit alpha Cav2.2)	EBI-7076778	0.51
Q02294	Voltage-dependent N-type calcium channel subunit alpha-1B (Brain calcium channel III) (BIII) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Voltage-gated calcium channel subunit alpha Cav2.2)	EBI-7076897	0.40
Q62889	Neuroligin-3 (Gliotactin homolog)	EBI-7414748	0.44
Q63373	Neurexin-1-beta (Neurexin I-beta)	EBI-7414873	0.27
P49768	Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) [Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)]	EBI-8513481	0.40
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-8513444	0.52
P52188	ATP-sensitive inward rectifier potassium channel 12 (Inward rectifier K(+) channel Kir2.2) (IRK-2) (Potassium channel, inwardly rectifying subfamily J member 12)	EBI-704679	0.35
P32851	Syntaxin-1A (Neuron-specific antigen HPC-1) (Synaptotagmin-associated 35 kDa protein) (P35A)	EBI-8545713	0.66
P61765	Syntaxin-binding protein 1 (N-Sec1) (Protein unc-18 homolog 1) (Unc18-1) (Protein unc-18 homolog A) (Unc-18A) (p67) (rbSec1)	EBI-2027999	0.62
Q24008	Inactivation-no-after-potential D protein	EBI-4307047	0.56

Cross-References

Database	Links
UNIPROT	O35430
PDB	4DBB 6KMH
Pfam	PF00595 PF00640
PROSITE	PS50106 PS01179

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK