Alpha-actinin-4 - Homo sapiens

Alpha-actinin-4 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Alpha-actinin-4
Accession Code	O43707
Gene	ACTN4
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 911)
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRD GLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISV EETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRV PQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEW LLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTI EEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEE QSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYD VENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCI ARMAPYQGPDAVPGALDYKSFSTALYGESDL

Structure Viewer (PDB: 6OA6)

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:22351778, Experimental EvidencePubMed:9508771}. Cytoplasm {Experimental EvidencePubMed:22351778, Experimental EvidencePubMed:9508771}. Cell junction {ECO:0000250\|UniProtKB:P57780}. Cytoplasm, cytoskeleton, stress fiber {Experimental EvidencePubMed:9508771}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:P57780}. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Expressed in the perinuclear rim and manchette structure in early elongating spermatids during spermiogenesis (By similarity). Nuclear translocation can be induced by the PI3 kinase inhibitor wortmannin or by cytochalasin D. Exclusively localized in the nucleus in a limited number of cell lines (breast cancer cell line MCF-7, oral floor cancer IMC-2, and bladder cancer KU- 7). {ECO:0000250\|UniProtKB:P57780, ECO:0000269\|PubMed:17289661, Experimental EvidencePubMed:9508771}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Actin Cytoskeleton (GO:0015629) Cell Junction (GO:0030054) Cell Projection (GO:0042995) Cortical Actin Cytoskeleton (GO:0030864) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Extracellular Region (GO:0005576) Extracellular Space (GO:0005615) Focal Adhesion (GO:0005925) Neuron Projection (GO:0043005) Nuclear Body (GO:0016604) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Platelet Alpha Granule Lumen (GO:0031093) Protein-Containing Complex (GO:0032991) Pseudopodium (GO:0031143) Ribonucleoprotein Complex (GO:1990904) Stress Fiber (GO:0001725) Z Disc (GO:0030018)

Biology & Function

Description
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein (Probable). Probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation (PubMed:15772161). Involved in tight junction assembly in epithelial cells probably through interaction with MICALL2. Links MICALL2 to the actin cytoskeleton and recruits it to the tight junctions (By similarity). May also function as a transcriptional coactivator, stimulating transcription mediated by the nuclear hormone receptors PPARG and RARA (PubMed:22351778). {By SimilarityUniProtKB:P57780, Experimental EvidencePubMed:15772161, Experimental EvidencePubMed:22351778, Curator InferencePubMed:9508771}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Muscle Cell Development (GO:0055001) Negative Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900025) Peroxisome Proliferator Activated Receptor Signaling Pathway (GO:0035357) Positive Regulation Of Cell Migration (GO:0030335) Positive Regulation Of NIK/NF-KappaB Signaling (GO:1901224) Positive Regulation Of Sodium:Proton Antiporter Activity (GO:0032417) Protein Transport (GO:0015031) Regulation Of Apoptotic Process (GO:0042981) Regulation Of Nucleic Acid-Templated Transcription (GO:1903506) Response To Hypoxia (GO:0001666) Retinoic Acid Receptor Signaling Pathway (GO:0048384) Tumor Necrosis Factor-Mediated Signaling Pathway (GO:0033209) Vesicle Transport Along Actin Filament (GO:0030050)
Molecular Function	Actin Binding (GO:0003779) Actin Filament Binding (GO:0051015) Calcium Ion Binding (GO:0005509) Chromatin DNA Binding (GO:0031490) Integrin Binding (GO:0005178) Nuclear Receptor Binding (GO:0016922) Nuclear Receptor Coactivator Activity (GO:0030374) Nuclear Retinoic Acid Receptor Binding (GO:0042974) Nucleoside Binding (GO:0001882) Protein Homodimerization Activity (GO:0042803) Protein N-Terminus Binding (GO:0047485) RNA Binding (GO:0003723) RNA Polymerase II Transcription Regulatory Region Sequence-Specific DNA Binding (GO:0000977) Transcription Coactivator Activity (GO:0003713) Transmembrane Transporter Binding (GO:0044325)

Disease associations

Description
Focal segmental glomerulosclerosis 1 (FSGS1) [MIM:603278]: A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and progressive decline in renal function. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation. {Experimental EvidencePubMed:10700177, Experimental EvidencePubMed:18164029, Experimental EvidencePubMed:18436095, Experimental EvidencePubMed:22351778, Experimental EvidencePubMed:22732337, Experimental EvidencePubMed:23014460, Experimental EvidencePubMed:23890478}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	603278 604638
DisGeNET	81

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P00533	Epidermal growth factor receptor	EBI-9689686	0.55
Q9UH99	SUN domain-containing protein 2	EBI-10761374	0.35
O94875	Sorbin and SH3 domain-containing protein 2	EBI-12689671	0.60
O43707	Self	EBI-15971763	0.40
P12931	Proto-oncogene tyrosine-protein kinase Src	EBI-25384369	0.35
Interactions with other proteins (114 interactors)

Partner (UniProt)		IntAct	Confidence score
P62993	Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2)	EBI-350217	0.35
Q99759	Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3)	EBI-362163	0.00
Q9Y572	Receptor-interacting serine/threonine-protein kinase 3 (EC 2.7.11.1) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3)	EBI-363781	0.00
Q9NPC6	Myozenin-2 (Calsarcin-1) (FATZ-related protein 2)	EBI-756484	0.93
Q9NP98	Myozenin-1 (Calsarcin-2) (Filamin-, actinin- and telethonin-binding protein) (Protein FATZ)	EBI-759703	0.37
O00151	PDZ and LIM domain protein 1 (C-terminal LIM domain protein 1) (Elfin) (LIM domain protein CLP-36)	EBI-760309	0.67
P12830	Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-727492	0.50
P38432	Coilin (p80-coilin)	EBI-952558	0.00
Q9NZJ4	Sacsin (DnaJ homolog subfamily C member 29) (DNAJC29)	EBI-953488	0.00
P63104	14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1)	EBI-7197640	0.40
Q07157	Tight junction protein ZO-1 (Tight junction protein 1) (Zona occludens protein 1) (Zonula occludens protein 1)	EBI-1103214	0.60
P35222	Catenin beta-1 (Beta-catenin)	EBI-1537638	0.68
P42771	Cyclin-dependent kinase inhibitor 2A (Cyclin-dependent kinase 4 inhibitor A) (CDK4I) (Multiple tumor suppressor 1) (MTS-1) (p16-INK4a) (p16-INK4) (p16INK4A)	EBI-1641665	0.35
Q69139	Nuclear antigen EBNA-3B	EBI-2623676	0.37
Q8TDR0	TRAF3-interacting protein 1 (Interleukin-13 receptor alpha 1-binding protein 1) (Intraflagellar transport protein 54 homolog) (Microtubule-interacting protein associated with TRAF3) (MIP-T3)	EBI-2650416	0.35
P29474	Nitric oxide synthase, endothelial (EC 1.14.13.39) (Constitutive NOS) (cNOS) (EC-NOS) (Endothelial NOS) (eNOS) (NOS type III) (NOSIII)	EBI-3385333	0.37
P42224	Signal transducer and activator of transcription 1-alpha/beta (Transcription factor ISGF-3 components p91/p84)	EBI-3451685	0.00
O15265	Ataxin-7 (Spinocerebellar ataxia type 7 protein)	EBI-3866243	0.37
Q9NUX5	Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein)	EBI-3925821	0.37
P52292	Importin subunit alpha-1 (Karyopherin subunit alpha-2) (RAG cohort protein 1) (SRP1-alpha)	EBI-3944055	0.37
Q13164	Mitogen-activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK-1) (Extracellular signal-regulated kinase 5) (ERK-5)	EBI-3944105	0.37
P42677	40S ribosomal protein S27 (Metallopan-stimulin 1) (MPS-1) (Small ribosomal subunit protein eS27)	EBI-3944125	0.37
P10599	Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) (allergen Hom s Trx)	EBI-3944155	0.44
Q8WZ42	Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)	EBI-5665670	0.00
Q3UQN2	F-BAR domain only protein 2	EBI-6097080	0.35
P19320	Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106)	EBI-6191076	0.53
P02751	Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3]	EBI-6285956	0.35
P04792	Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress-responsive protein 27) (SRP27)	EBI-6870912	0.37
P46940	Ras GTPase-activating-like protein IQGAP1 (p195)	EBI-6897999	0.60
Q5L4H4	Nucleoprotein (Nucleocapsid protein) (Protein N)	EBI-9512219	0.59
P03466	Nucleoprotein (Nucleocapsid protein) (Protein N)	EBI-9512541	0.40
C3W6D7	Nucleoprotein (Nucleocapsid protein) (Protein N)	EBI-9513951	0.40
Q91U50	Nucleoprotein (Nucleocapsid protein) (Protein N)	EBI-9514006	0.40
Q6DPG0	Nucleoprotein	EBI-9513984	0.40
B2BU63	Nucleoprotein	EBI-9513930	0.40
C9S3S8	Nucleoprotein (Nucleocapsid protein) (Protein N)	EBI-9513909	0.40
Q8JR21	Nucleoprotein	EBI-9514040	0.27
Q38SD2	Leucine-rich repeat serine/threonine-protein kinase 1 (EC 2.7.11.1)	EBI-9656528	0.35
O41957	40 protein (Helicase-primase)	EBI-9640710	0.37
Q92754	Transcription factor AP-2 gamma (AP2-gamma) (Activating enhancer-binding protein 2 gamma) (Transcription factor ERF-1)	EBI-9680045	0.37
P05549	Transcription factor AP-2-alpha (AP2-alpha) (AP-2 transcription factor) (Activating enhancer-binding protein 2-alpha) (Activator protein 2) (AP-2)	EBI-9679922	0.37
P67809	Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor)	EBI-9985228	0.35
A8K571	Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b (cDNA FLJ78019, highly similar to Homo sapiens bone morphogenetic protein 7 (osteogenic protein 1), mRNA) (cDNA, FLJ92758, Homo sapiens bone morphogenetic protein 7 (osteogenic protein 1)(BMP7), mRNA)	EBI-10174341	0.56
B2R8Y4	cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA	EBI-10175592	0.56
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-9996267	0.35
Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	EBI-9996422	0.35
P35579	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11004631	0.35
Q9NQW6	Anillin	EBI-11009421	0.35
Q9CQ49	Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (NCBP 20 kDa subunit) (CBP20)	EBI-11022137	0.35
Q60634	Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1 homolog)	EBI-11025478	0.35
Q92614	Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210)	EBI-11030093	0.35
O00159	Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb)	EBI-11030803	0.35
Q96H55	Unconventional myosin-XIX (Myosin head domain-containing protein 1)	EBI-11031416	0.35
P21333	Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin)	EBI-11038784	0.35
P60710	Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed]	EBI-11045267	0.35
Q80X90	Filamin-B (FLN-B) (ABP-280-like protein) (Actin-binding-like protein) (Beta-filamin)	EBI-11053320	0.35
Q9ERG0	LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) (mEPLIN)	EBI-11054044	0.35
Q9UHB6	LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm)	EBI-11058729	0.35
Q9D6P8	Calmodulin-like protein 3	EBI-11062262	0.35
Q9JHJ0	Tropomodulin-3 (Ubiquitous tropomodulin) (U-Tmod)	EBI-11063313	0.35
P58771	Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1)	EBI-11063826	0.35
Q9WUM4	Coronin-1C (Coronin-3)	EBI-11065690	0.35
Q9P2K5	Myelin expression factor 2 (MEF-2) (MyEF-2) (MST156)	EBI-11077096	0.35
Q16643	Drebrin (Developmentally-regulated brain protein)	EBI-11080402	0.35
O75182	Paired amphipathic helix protein Sin3b (Histone deacetylase complex subunit Sin3b) (Transcriptional corepressor Sin3b)	EBI-11085017	0.35
Q8N3V7	Synaptopodin	EBI-11086992	0.35
Q15691	Microtubule-associated protein RP/EB family member 1 (APC-binding protein EB1) (End-binding protein 1) (EB1)	EBI-11091481	0.35
Q8VDD5	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11092730	0.35
Q9WTI7	Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb)	EBI-11093786	0.35
Q61879	Myosin-10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non-muscle IIb) (Non-muscle myosin heavy chain B) (NMMHC-B) (Non-muscle myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB)	EBI-11099615	0.35
Q9NQX4	Unconventional myosin-Vc	EBI-11100755	0.35
Q9NR12	PDZ and LIM domain protein 7 (LIM mineralization protein) (LMP) (Protein enigma)	EBI-11105742	0.53
P47755	F-actin-capping protein subunit alpha-2 (CapZ alpha-2)	EBI-11117728	0.35
P62140	Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53)	EBI-11142496	0.35
Q15599	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 (NHERF-2) (NHE3 kinase A regulatory protein E3KARP) (SRY-interacting protein 1) (SIP-1) (Sodium-hydrogen exchanger regulatory factor 2) (Solute carrier family 9 isoform A3 regulatory factor 2) (Tyrosine kinase activator protein 1) (TKA-1)	EBI-12452194	0.51
Q14160	Protein scribble homolog (Scribble) (hScrib) (Protein LAP4)	EBI-11794686	0.40
Q9NWQ9	Uncharacterized protein C14orf119	EBI-24303215	0.56
Q8IY33	MICAL-like protein 2 (Junctional Rab13-binding protein) (Molecule interacting with CasL-like 2) (MICAL-L2)	EBI-24365113	0.56
Q08043	Alpha-actinin-3 (Alpha-actinin skeletal muscle isoform 3) (F-actin cross-linking protein)	EBI-24497993	0.56
Q8TBB1	E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX)	EBI-24475492	0.56
O60294	tRNA wybutosine-synthesizing protein 4 (tRNA yW-synthesizing protein 4) (EC 2.1.1.290) (EC 2.3.1.231) (Leucine carboxyl methyltransferase 2) (tRNA(Phe) (7-(3-amino-3-(methoxycarbonyl)propyl)wyosine(37)-N)-methoxycarbonyltransferase) (tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-O)-methyltransferase)	EBI-12697987	0.56
P50222	Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2)	EBI-12702268	0.56
O15297	Protein phosphatase 1D (EC 3.1.3.16) (Protein phosphatase 2C isoform delta) (PP2C-delta) (Protein phosphatase magnesium-dependent 1 delta) (p53-induced protein phosphatase 1)	EBI-14024588	0.35
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
P10276	Retinoic acid receptor alpha (RAR-alpha) (Nuclear receptor subfamily 1 group B member 1)	EBI-15971728	0.52
P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	EBI-15971696	0.40
P09622	Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein)	EBI-20304669	0.35
O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	EBI-20305770	0.35
P08559	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)	EBI-20306509	0.35
P00441	Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1)	EBI-20307497	0.35
P69968	Protein TyeA	EBI-20817323	0.37
Q8D0P1	Chemotaxis protein CheY	EBI-20818271	0.37
P46013	Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67)	EBI-20562326	0.35
P35408	Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)	EBI-20811214	0.37
P51957	Serine/threonine-protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A-related kinase 4) (NimA-related protein kinase 4) (Serine/threonine-protein kinase 2) (Serine/threonine-protein kinase NRK2)	EBI-20721387	0.35
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21024514	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
P61981	14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]	EBI-26966879	0.35
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
P04156	Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230)	EBI-21014477	0.35
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-25416349	0.35
Q8N5H7	SH2 domain-containing protein 3C (Cas/HEF1-associated signal transducer) (Chat-H) (Novel SH2-containing protein 3) (SH2 domain-containing Eph receptor-binding protein 1) (SHEP1)	EBI-25387159	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
Q9H3R0	Lysine-specific demethylase 4C (EC 1.14.11.66) (Gene amplified in squamous cell carcinoma 1 protein) (GASC-1 protein) (JmjC domain-containing histone demethylation protein 3C) (Jumonji domain-containing protein 2C) ([histone H3]-trimethyl-L-lysine(9) demethylase 4C)	EBI-25479978	0.35
P83105	Serine protease HTRA4 (EC 3.4.21.-) (High-temperature requirement factor A4)	EBI-25745135	0.35
Q13363	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-)	EBI-27044482	0.35
Q99592	Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171)	EBI-27093179	0.35
P53355	Death-associated protein kinase 1 (DAP kinase 1) (EC 2.7.11.1)	EBI-28938354	0.35
Q05513	Protein kinase C zeta type (EC 2.7.11.13) (nPKC-zeta)	EBI-28938998	0.35
Q86V86	Serine/threonine-protein kinase pim-3 (EC 2.7.11.1)	EBI-28942203	0.35
Q8TEA7	TBC domain-containing protein kinase-like protein	EBI-28943849	0.35
Q8TF76	Serine/threonine-protein kinase haspin (EC 2.7.11.1) (Germ cell-specific gene 2 protein) (H-haspin) (Haploid germ cell-specific nuclear protein kinase)	EBI-28943924	0.35
Q9Y2U5	Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.11.25) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2)	EBI-28947216	0.35
Q8WYL5	Protein phosphatase Slingshot homolog 1 (EC 3.1.3.16) (EC 3.1.3.48) (SSH-like protein 1) (SSH-1L) (hSSH-1L)	EBI-27116808	0.27

Cross-References

Database	Links
UNIPROT	O43707 A4K467 D6PXK4 O76048
PDB	1WLX 1YDI 2R0O 6O31 6OA6
Pfam	PF00307 PF08726 PF00435
PROSITE	PS00019 PS00020 PS50021 PS00018 PS50222
OMIM	603278 604638
DisGeNET	81

Alpha-actinin-4 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 6OA6)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (5 interactors)

Interactions with other proteins (114 interactors)

Cross-References

Database

Links

Description

Description