Protein Information |
|
---|---|
Protein Name | Proto-oncogene tyrosine-protein kinase Src |
Accession Code | P12931 |
Gene | SRC |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 536) | |
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAG PLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRE SERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKL RHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGEN LVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL |
Structure Viewer (PDB: 2SRC) |
---|
Description |
|
---|---|
Note=SRC kinase activity has been shown to be increased in several tumor tissues and tumor cell lines such as colon carcinoma cells. {Experimental EvidencePubMed:2498394, Experimental EvidencePubMed:3093483}. Thrombocytopenia 6 (THC6) [MIM:616937]: A form of thrombocytopenia, a hematologic disorder defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting. THC6 is an autosomal dominant form. Affected individuals may also have bone abnormalities and an increased risk for myelofibrosis. {Experimental EvidencePubMed:26936507}. Note=The disease is caused by variants affecting the gene represented in this entry. | Database Associations |
OMIM | 190090 616937 |
DisGeNET | 6714 |
Interactions with Nuclear Envelope proteins (21 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
P12931 | Self | EBI-7173747 | 0.44 |
P21980 | Protein-glutamine gamma-glutamyltransferase 2 | EBI-15828007 | 0.40 |
Q9WUD9 | Proto-oncogene tyrosine-protein kinase Src | EBI-22249049 | 0.35 |
Q8TEL6 | Short transient receptor potential channel 4-associated protein | EBI-28931938 | 0.35 |
P00519 | Tyrosine-protein kinase ABL1 | EBI-7286298 | 0.59 |
O43707 | Alpha-actinin-4 | EBI-25384369 | 0.35 |
Q13023 | A-kinase anchor protein 6 | EBI-1960946 | 0.40 |
Q9NQI0 | Probable ATP-dependent RNA helicase DDX4 | EBI-7609853 | 0.40 |
P00533 | Epidermal growth factor receptor | EBI-7248693 | 0.90 |
P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-8289901 | 0.71 |
P70424 | Receptor tyrosine-protein kinase erbB-2 | EBI-5451946 | 0.40 |
Q05397 | Focal adhesion kinase 1 | EBI-968957 | 0.92 |
P34152 | Focal adhesion kinase 1 | EBI-7921275 | 0.56 |
Q14289 | Protein-tyrosine kinase 2-beta | EBI-7095687 | 0.64 |
Q05655 | Protein kinase C delta type catalytic subunit | EBI-7607017 | 0.40 |
Q14693 | Phosphatidate phosphatase LPIN1 | EBI-25892196 | 0.56 |
Q96AG4 | Leucine-rich repeat-containing protein 59, N-terminally processed | EBI-25384369 | 0.35 |
P07948 | Tyrosine-protein kinase Lyn | EBI-11359552 | 0.67 |
Q13177 | PAK-2p34 | EBI-7975714 | 0.52 |
P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-27092586 | 0.44 |
P01112 | GTPase HRas, N-terminally processed | EBI-8633225 | 0.57 | Interactions with other proteins (380 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P25962 | Beta-3 adrenergic receptor (Beta-3 adrenoreceptor) (Beta-3 adrenoceptor) | EBI-7406154 | 0.54 |
P15941 | Mucin-1 (MUC-1) (Breast carcinoma-associated antigen DF3) (Cancer antigen 15-3) (CA 15-3) (Carcinoma-associated mucin) (Episialin) (H23AG) (Krebs von den Lungen-6) (KL-6) (PEMT) (Peanut-reactive urinary mucin) (PUM) (Polymorphic epithelial mucin) (PEM) (Tumor-associated epithelial membrane antigen) (EMA) (Tumor-associated mucin) (CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha (MUC1-NT) (MUC1-alpha); Mucin-1 subunit beta (MUC1-beta) (MUC1-CT)] | EBI-7913825 | 0.75 |
P17302 | Gap junction alpha-1 protein (Connexin-43) (Cx43) (Gap junction 43 kDa heart protein) | EBI-7413469 | 0.35 |
Q16832 | Discoidin domain-containing receptor 2 (Discoidin domain receptor 2) (EC 2.7.10.1) (CD167 antigen-like family member B) (Discoidin domain-containing receptor tyrosine kinase 2) (Neurotrophic tyrosine kinase, receptor-related 3) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO10) (CD antigen CD167b) | EBI-8168082 | 0.40 |
Q03135 | Caveolin-1 | EBI-8675931 | 0.32 |
Q02248 | Catenin beta-1 (Beta-catenin) | EBI-8624542 | 0.44 |
Q8R5G7 | Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (Centaurin-delta-3) (Cnt-d3) (Dual specificity Rho- and Arf-GTPase-activating protein 1) | EBI-621510 | 0.56 |
Q9H5V8 | CUB domain-containing protein 1 (Membrane glycoprotein gp140) (Subtractive immunization M plus HEp3-associated 135 kDa protein) (SIMA135) (Transmembrane and associated with src kinases) (CD antigen CD318) | EBI-7606952 | 0.79 |
Q05193 | Dynamin-1 (EC 3.6.5.5) | EBI-7591679 | 0.44 |
P50570 | Dynamin-2 (EC 3.6.5.5) | EBI-7591812 | 0.44 |
Q60749 | KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) | EBI-697861 | 0.44 |
Q9Y6K9 | NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier) | EBI-697929 | 0.50 |
O15111 | Inhibitor of nuclear factor kappa-B kinase subunit alpha (I-kappa-B kinase alpha) (IKK-A) (IKK-alpha) (IkBKA) (IkappaB kinase) (EC 2.7.11.10) (Conserved helix-loop-helix ubiquitous kinase) (I-kappa-B kinase 1) (IKK1) (Nuclear factor NF-kappa-B inhibitor kinase alpha) (NFKBIKA) (Transcription factor 16) (TCF-16) | EBI-697951 | 0.35 |
O14920 | Inhibitor of nuclear factor kappa-B kinase subunit beta (I-kappa-B-kinase beta) (IKK-B) (IKK-beta) (IkBKB) (EC 2.7.11.10) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB) (Serine/threonine protein kinase IKBKB) (EC 2.7.11.1) | EBI-697951 | 0.35 |
Q07666 | KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) | EBI-2437436 | 0.57 |
Q8WUM4 | Programmed cell death 6-interacting protein (PDCD6-interacting protein) (ALG-2-interacting protein 1) (ALG-2-interacting protein X) (Hp95) | EBI-7397413 | 0.65 |
P03407 | Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein] | EBI-7355101 | 0.40 |
Q9QPN3 | Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein] | EBI-7355187 | 0.40 |
P04604 | Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein] | EBI-7355423 | 0.40 |
P21860 | Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3) | EBI-7885161 | 0.44 |
P52800 | Ephrin-B2 (ELF-2) (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L) | EBI-8107779 | 0.40 |
P12814 | Alpha-actinin-1 (Alpha-actinin cytoskeletal isoform) (F-actin cross-linking protein) (Non-muscle alpha-actinin-1) | EBI-968854 | 0.52 |
Q90VU7 | Protein Nef (3'ORF) (Negative factor) (F-protein) [Cleaved into: C-terminal core protein] | EBI-7975353 | 0.40 |
Q13444 | Disintegrin and metalloproteinase domain-containing protein 15 (ADAM 15) (EC 3.4.24.-) (Metalloprotease RGD disintegrin protein) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metargidin) | EBI-7976357 | 0.75 |
O15455 | Toll-like receptor 3 (CD antigen CD283) | EBI-8580898 | 0.46 |
P09848 | Lactase/phlorizin hydrolase (Lactase/glycosylceramidase) [Includes: Lactase (EC 3.2.1.108); Glycosylceramidase (EC 3.2.1.62) (Phlorizin hydrolase)] | EBI-7047891 | 0.44 |
P06241 | Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn) | EBI-6967679 | 0.56 |
P42227 | Signal transducer and activator of transcription 3 (Acute-phase response factor) | EBI-1163828 | 0.44 |
Q63767 | Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (p130cas) | EBI-1176840 | 0.44 |
P22681 | E3 ubiquitin-protein ligase CBL (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene) (Proto-oncogene c-Cbl) (RING finger protein 55) (RING-type E3 ubiquitin transferase CBL) (Signal transduction protein CBL) | EBI-7146896 | 0.84 |
P07550 | Beta-2 adrenergic receptor (Beta-2 adrenoreceptor) (Beta-2 adrenoceptor) | EBI-7173594 | 0.61 |
P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | EBI-1200966 | 0.44 |
Q9H204 | Mediator of RNA polymerase II transcription subunit 28 (Endothelial-derived protein 1) (Mediator complex subunit 28) (Merlin and Grb2-interacting cytoskeletal protein) (Magicin) (Tumor angiogenesis marker EG-1) | EBI-1206815 | 0.66 |
P55196 | Afadin (ALL1-fused gene from chromosome 6 protein) (Protein AF-6) (Afadin adherens junction formation factor) | EBI-7407779 | 0.65 |
Q9C0H9 | SRC kinase signaling inhibitor 1 (SNAP-25-interacting protein) (SNIP) (p130Cas-associated protein) (p140Cap) | EBI-2658373 | 0.40 |
P41240 | Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-Src kinase) (Protein-tyrosine kinase CYL) | EBI-2658427 | 0.40 |
Q9QWI6 | SRC kinase signaling inhibitor 1 (SNAP-25-interacting protein) (SNIP) (p130Cas-associated protein) (p140Cap) | EBI-2658513 | 0.40 |
Q9ULH1 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differentiation-enhancing factor 1) (DEF-1) (Differentiation-enhancing factor 1) (PIP2-dependent ARF1 GAP) | EBI-1960274 | 0.61 |
Q92988 | Homeobox protein DLX-4 (Beta protein 1) (Homeobox protein DLX-7) (Homeobox protein DLX-8) | EBI-1960262 | 0.40 |
Q8IZD9 | Dedicator of cytokinesis protein 3 (Modifier of cell adhesion) (Presenilin-binding protein) (PBP) | EBI-1960286 | 0.40 |
O15360 | Fanconi anemia group A protein (Protein FACA) | EBI-1960310 | 0.40 |
P43699 | Homeobox protein Nkx-2.1 (Homeobox protein NK-2 homolog A) (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) (Thyroid-specific enhancer-binding protein) (T/EBP) | EBI-1960322 | 0.40 |
O75167 | Phosphatase and actin regulator 2 | EBI-1960334 | 0.40 |
Q9P1A6 | Disks large-associated protein 2 (DAP-2) (PSD-95/SAP90-binding protein 2) (SAP90/PSD-95-associated protein 2) (SAPAP2) | EBI-1960358 | 0.40 |
Q15036 | Sorting nexin-17 | EBI-1960382 | 0.40 |
Q9Y2H0 | Disks large-associated protein 4 (DAP-4) (PSD-95/SAP90-binding protein 4) (SAP90/PSD-95-associated protein 4) (SAPAP-4) | EBI-1960370 | 0.40 |
O43918 | Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (APECED protein) | EBI-1960394 | 0.40 |
O95886 | Disks large-associated protein 3 (DAP-3) (PSD-95/SAP90-binding protein 3) (SAP90/PSD-95-associated protein 3) (SAPAP3) | EBI-1960406 | 0.40 |
Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | EBI-1960418 | 0.40 |
O43150 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (Development and differentiation-enhancing factor 2) (Paxillin-associated protein with ARF GAP activity 3) (PAG3) (Pyk2 C-terminus-associated protein) (PAP) | EBI-1960430 | 0.40 |
Q9NQ76 | Matrix extracellular phosphoglycoprotein (Osteoblast/osteocyte factor 45) (OF45) (Osteoregulin) | EBI-1960442 | 0.40 |
Q9Y2J2 | Band 4.1-like protein 3 (4.1B) (Differentially expressed in adenocarcinoma of the lung protein 1) (DAL-1) (Erythrocyte membrane protein band 4.1-like 3) [Cleaved into: Band 4.1-like protein 3, N-terminally processed] | EBI-1960454 | 0.40 |
P20810 | Calpastatin (Calpain inhibitor) (Sperm BS-17 component) | EBI-1960466 | 0.40 |
Q9NZM4 | BRD4-interacting chromatin-remodeling complex-associated protein (Glioma tumor suppressor candidate region gene 1 protein) | EBI-1960478 | 0.40 |
Q9H1R2 | Dual specificity protein phosphatase 15 (EC 3.1.3.16) (EC 3.1.3.48) (VH1-related member Y) (Vaccinia virus VH1-related dual-specific protein phosphatase Y) | EBI-1960490 | 0.40 |
P15586 | N-acetylglucosamine-6-sulfatase (EC 3.1.6.14) (Glucosamine-6-sulfatase) (G6S) | EBI-1960502 | 0.40 |
P31995 | Low affinity immunoglobulin gamma Fc region receptor II-c (IgG Fc receptor II-c) (CDw32) (Fc-gamma RII-c) (Fc-gamma-RIIc) (FcRII-c) (CD antigen CD32) | EBI-1960538 | 0.40 |
P31994 | Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32) | EBI-1960526 | 0.40 |
P31273 | Homeobox protein Hox-C8 (Homeobox protein Hox-3A) | EBI-1960514 | 0.40 |
O43909 | Exostosin-like 3 (EC 2.4.1.223) (EXT-related protein 1) (Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Hereditary multiple exostoses gene isolog) (Multiple exostosis-like protein 3) (Putative tumor suppressor protein EXTL3) | EBI-1960562 | 0.40 |
P23759 | Paired box protein Pax-7 (HuP1) | EBI-1960550 | 0.40 |
P26373 | 60S ribosomal protein L13 (Breast basic conserved protein 1) (Large ribosomal subunit protein eL13) | EBI-1960574 | 0.40 |
Q9NRJ4 | Tubby-related protein 4 (Tubby superfamily protein) (Tubby-like protein 4) | EBI-1960586 | 0.40 |
O14490 | Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (hGKAP) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1) | EBI-1960598 | 0.40 |
Q96Q35 | Flagellum-associated coiled-coil domain-containing protein 1 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein) | EBI-1960610 | 0.40 |
O95157 | Neurexophilin-3 | EBI-1960622 | 0.40 |
Q13905 | Rap guanine nucleotide exchange factor 1 (CRK SH3-binding GNRP) (Guanine nucleotide-releasing factor 2) (Protein C3G) | EBI-1960634 | 0.40 |
Q9UPX8 | SH3 and multiple ankyrin repeat domains protein 2 (Shank2) (Cortactin-binding protein 1) (CortBP1) (Proline-rich synapse-associated protein 1) | EBI-1960646 | 0.40 |
Q13796 | Protein Shroom2 (Apical-like protein) (Protein APXL) | EBI-1960658 | 0.40 |
P49916 | DNA ligase 3 (EC 6.5.1.1) (DNA ligase III) (Polydeoxyribonucleotide synthase [ATP] 3) | EBI-1960670 | 0.40 |
O15371 | Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66) | EBI-1960682 | 0.40 |
Q8TB24 | Ras and Rab interactor 3 (Ras interaction/interference protein 3) | EBI-1960694 | 0.40 |
O43281 | Embryonal Fyn-associated substrate (hEFS) (Cas scaffolding protein family member 3) | EBI-1960706 | 0.40 |
P42684 | Tyrosine-protein kinase ABL2 (EC 2.7.10.2) (Abelson murine leukemia viral oncogene homolog 2) (Abelson tyrosine-protein kinase 2) (Abelson-related gene protein) (Tyrosine-protein kinase ARG) | EBI-1960730 | 0.40 |
Q9UL51 | Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 (Brain cyclic nucleotide-gated channel 2) (BCNG-2) | EBI-1960718 | 0.40 |
Q9NZV5 | Selenoprotein N (SelN) | EBI-1960742 | 0.40 |
Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) | EBI-1960754 | 0.40 |
Q9H9L3 | Interferon-stimulated 20 kDa exonuclease-like 2 (EC 3.1.-.-) | EBI-1960766 | 0.40 |
Q9BWW9 | Apolipoprotein L5 (Apolipoprotein L-V) (ApoL-V) | EBI-1960778 | 0.40 |
Q14008 | Cytoskeleton-associated protein 5 (Colonic and hepatic tumor overexpressed gene protein) (Ch-TOG) | EBI-1960802 | 0.40 |
Q07890 | Son of sevenless homolog 2 (SOS-2) | EBI-1960790 | 0.40 |
Q92918 | Mitogen-activated protein kinase kinase kinase kinase 1 (EC 2.7.11.1) (Hematopoietic progenitor kinase) (MAPK/ERK kinase kinase kinase 1) (MEK kinase kinase 1) (MEKKK 1) | EBI-1960814 | 0.40 |
O00254 | Proteinase-activated receptor 3 (PAR-3) (Coagulation factor II receptor-like 2) (Thrombin receptor-like 2) | EBI-1960826 | 0.40 |
Q13087 | Protein disulfide-isomerase A2 (EC 5.3.4.1) (Pancreas-specific protein disulfide isomerase) (PDIp) | EBI-1960838 | 0.40 |
P78345 | Ribonuclease P protein subunit p38 (RNaseP protein p38) | EBI-1960850 | 0.40 |
Q8IWT3 | Cullin-9 (CUL-9) (UbcH7-associated protein 1) (p53-associated parkin-like cytoplasmic protein) | EBI-1960862 | 0.40 |
P08047 | Transcription factor Sp1 | EBI-1960874 | 0.40 |
Q14185 | Dedicator of cytokinesis protein 1 (180 kDa protein downstream of CRK) (DOCK180) | EBI-1960886 | 0.40 |
Q86X10 | Ral GTPase-activating protein subunit beta (p170) | EBI-1960898 | 0.40 |
Q9HCU4 | Cadherin EGF LAG seven-pass G-type receptor 2 (Cadherin family member 10) (Epidermal growth factor-like protein 2) (EGF-like protein 2) (Flamingo homolog 3) (Multiple epidermal growth factor-like domains protein 3) (Multiple EGF-like domains protein 3) | EBI-1960922 | 0.40 |
P23760 | Paired box protein Pax-3 (HuP2) | EBI-1960958 | 0.40 |
Q07889 | Son of sevenless homolog 1 (SOS-1) | EBI-1960934 | 0.40 |
Q05996 | Zona pellucida sperm-binding protein 2 (Zona pellucida glycoprotein 2) (Zp-2) (Zona pellucida protein A) [Cleaved into: Processed zona pellucida sperm-binding protein 2] | EBI-1960970 | 0.40 |
P28340 | DNA polymerase delta catalytic subunit (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase subunit delta p125) | EBI-1960982 | 0.40 |
Q14118 | Dystroglycan 1 (Dystroglycan) (Dystrophin-associated glycoprotein 1) [Cleaved into: Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)] | EBI-1960994 | 0.40 |
O60493 | Sorting nexin-3 (Protein SDP3) | EBI-1961006 | 0.40 |
Q96NS5 | Ankyrin repeat and SOCS box protein 16 (ASB-16) | EBI-1961030 | 0.40 |
P20774 | Mimecan (Osteoglycin) (Osteoinductive factor) (OIF) | EBI-1961018 | 0.40 |
P46013 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67) | EBI-1961042 | 0.40 |
P48960 | Adhesion G protein-coupled receptor E5 (Leukocyte antigen CD97) (CD antigen CD97) [Cleaved into: Adhesion G protein-coupled receptor E5 subunit alpha; Adhesion G protein-coupled receptor E5 subunit beta] | EBI-1961054 | 0.40 |
P78329 | Cytochrome P450 4F2 (EC 1.14.14.1) (20-hydroxyeicosatetraenoic acid synthase) (20-HETE synthase) (Arachidonic acid omega-hydroxylase) (CYPIVF2) (Cytochrome P450-LTB-omega) (Docosahexaenoic acid omega-hydroxylase) (EC 1.14.14.79) (Leukotriene-B(4) 20-monooxygenase 1) (Leukotriene-B(4) omega-hydroxylase 1) (EC 1.14.14.94) (Phylloquinone omega-hydroxylase CYP4F2) (EC 1.14.14.78) | EBI-1961078 | 0.40 |
Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 (Centaurin-beta-1) (Cnt-b1) | EBI-1961090 | 0.40 |
P47928 | DNA-binding protein inhibitor ID-4 (Class B basic helix-loop-helix protein 27) (bHLHb27) (Inhibitor of DNA binding 4) (Inhibitor of differentiation 4) | EBI-1961114 | 0.40 |
O43900 | Prickle planar cell polarity protein 3 (LIM domain only protein 6) (LMO-6) (Prickle-like protein 3) (Pk3) (Triple LIM domain protein 6) | EBI-1961102 | 0.40 |
P10301 | Ras-related protein R-Ras (EC 3.6.5.-) (p23) | EBI-1961138 | 0.40 |
Q9Y2D5 | A-kinase anchor protein 2 (AKAP-2) (AKAP-KL) (Protein kinase A-anchoring protein 2) (PRKA2) | EBI-1961126 | 0.40 |
P49023 | Paxillin | EBI-7066367 | 0.35 |
P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-7248693 | 0.85 |
P25445 | Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95) | EBI-1648094 | 0.40 |
Q8TBB1 | E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX) | EBI-7649813 | 0.56 |
P0CG48 | Polyubiquitin-C [Cleaved into: Ubiquitin] | EBI-7650187 | 0.40 |
O70263 | E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb protein X 1) (Ligand of Numb-binding protein 1) (Numb-binding protein 1) (RING-type E3 ubiquitin transferase LNX) | EBI-7650384 | 0.40 |
P16284 | Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31) | EBI-1766207 | 0.59 |
P18031 | Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B) | EBI-8688791 | 0.94 |
Q62884 | Protein-tyrosine-phosphatase (EC 3.1.3.48) | EBI-7505047 | 0.60 |
P61978 | Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP) | EBI-7185667 | 0.59 |
Q13191 | E3 ubiquitin-protein ligase CBL-B (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) (RING-type E3 ubiquitin transferase CBL-B) (SH3-binding protein CBL-B) (Signal transduction protein CBL-B) | EBI-7081394 | 0.40 |
P56945 | Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas) | EBI-7040544 | 0.69 |
P27635 | 60S ribosomal protein L10 (Laminin receptor homolog) (Large ribosomal subunit protein uL16) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM) | EBI-8537576 | 0.59 |
P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-7796404 | 0.44 |
P04370 | Myelin basic protein (MBP) (Myelin A1 protein) | EBI-7728029 | 0.40 |
P27986 | Phosphatidylinositol 3-kinase regulatory subunit alpha (PI3-kinase regulatory subunit alpha) (PI3K regulatory subunit alpha) (PtdIns-3-kinase regulatory subunit alpha) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha) (PI3-kinase subunit p85-alpha) (PtdIns-3-kinase regulatory subunit p85-alpha) | EBI-7585571 | 0.78 |
P60709 | Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-7585640 | 0.27 |
Q80YS6 | Actin filament-associated protein 1 (110 kDa actin filament-associated protein) (AFAP-110) | EBI-7295737 | 0.40 |
P13645 | Keratin, type I cytoskeletal 10 (Cytokeratin-10) (CK-10) (Keratin-10) (K10) | EBI-7609832 | 0.40 |
Q4V348 | Zinc finger protein 658B | EBI-7609909 | 0.40 |
P35326 | Small proline-rich protein 2A (SPR-2A) (2-1) | EBI-7743289 | 0.60 |
P48023 | Tumor necrosis factor ligand superfamily member 6 (Apoptosis antigen ligand) (APTL) (CD95 ligand) (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form (Receptor-binding FasL ectodomain) (Soluble Fas ligand) (sFasL); ADAM10-processed FasL form (APL); FasL intracellular domain (FasL ICD) (SPPL2A-processed FasL form) (SPA)] | EBI-2481635 | 0.40 |
Q13094 | Lymphocyte cytosolic protein 2 (SH2 domain-containing leukocyte protein of 76 kDa) (SLP-76 tyrosine phosphoprotein) (SLP76) | EBI-7643766 | 0.40 |
P18052 | Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) (EC 3.1.3.48) (LCA-related phosphatase) (PTPTY-28) | EBI-7811172 | 0.40 |
Q68CZ2 | Tensin-3 (Tensin-like SH2 domain-containing protein 1) (Tumor endothelial marker 6) | EBI-2607034 | 0.59 |
Q8IZP0 | Abl interactor 1 (Abelson interactor 1) (Abi-1) (Abl-binding protein 4) (AblBP4) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Nap1-binding protein) (Nap1BP) (Spectrin SH3 domain-binding protein 1) (e3B1) | EBI-8050301 | 0.44 |
P97288 | 5-hydroxytryptamine receptor 4 (5-HT-4) (5-HT4) (Serotonin receptor 4) | EBI-7149469 | 0.54 |
P35968 | Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309) | EBI-2899201 | 0.77 |
P08581 | Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto-oncogene c-Met) (Scatter factor receptor) (SF receptor) (Tyrosine-protein kinase Met) | EBI-2927759 | 0.70 |
P18433 | Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) (EC 3.1.3.48) | EBI-7205168 | 0.66 |
P23743 | Diacylglycerol kinase alpha (DAG kinase alpha) (EC 2.7.1.107) (80 kDa diacylglycerol kinase) (Diglyceride kinase alpha) (DGK-alpha) | EBI-7559520 | 0.46 |
P35918 | Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase NYK) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309) | EBI-8425905 | 0.35 |
P09619 | Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b) | EBI-8606171 | 0.35 |
P33151 | Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144) | EBI-8609007 | 0.35 |
Q9NWQ8 | Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (Csk-binding protein) (Transmembrane adapter protein PAG) (Transmembrane phosphoprotein Cbp) | EBI-11358847 | 0.35 |
P40763 | Signal transducer and activator of transcription 3 (Acute-phase response factor) | EBI-11359552 | 0.53 |
O60674 | Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2) | EBI-3133061 | 0.35 |
P68400 | Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1) | EBI-3133113 | 0.56 |
P21333 | Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin) | EBI-3451163 | 0.00 |
Q8WX93 | Palladin (SIH002) (Sarcoma antigen NY-SAR-77) | EBI-7432098 | 0.40 |
Q9WNA9 | K15 (Latent membrane protein) (Latent signal transducing membrane protein) | EBI-7555504 | 0.44 |
Q7Z7K6 | Centromere protein V (CENP-V) (Nuclear protein p30) (Proline-rich protein 6) | EBI-7613065 | 0.40 |
P05023 | Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1) | EBI-4303332 | 0.35 |
Q16825 | Tyrosine-protein phosphatase non-receptor type 21 (EC 3.1.3.48) (Protein-tyrosine phosphatase D1) | EBI-7186498 | 0.40 |
O08715 | A-kinase anchor protein 1, mitochondrial (Dual specificity A-kinase-anchoring protein 1) (D-AKAP-1) (Protein kinase A-anchoring protein 1) (PRKA1) (Spermatid A-kinase anchor protein) (S-AKAP) | EBI-7186509 | 0.40 |
Q14194 | Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3) | EBI-7392387 | 0.37 |
Q06124 | Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3) | EBI-7870944 | 0.44 |
P08962 | CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63) | EBI-7784524 | 0.40 |
Q03348 | Receptor-type tyrosine-protein phosphatase alpha (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) (EC 3.1.3.48) | EBI-7784512 | 0.40 |
Q9H3S7 | Tyrosine-protein phosphatase non-receptor type 23 (EC 3.1.3.48) (His domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) | EBI-8423677 | 0.50 |
P12830 | Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-5922639 | 0.50 |
Q75N03 | E3 ubiquitin-protein ligase Hakai (EC 2.3.2.27) (Casitas B-lineage lymphoma-transforming sequence-like protein 1) (c-Cbl-like protein 1) (RING finger protein 188) (RING-type E3 ubiquitin transferase Hakai) | EBI-5922652 | 0.35 |
Q01973 | Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1) | EBI-6082870 | 0.68 |
Q00993 | Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (Adhesion-related kinase) | EBI-7694934 | 0.40 |
P30530 | Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene) | EBI-7695010 | 0.40 |
P21145 | Myelin and lymphocyte protein (T-lymphocyte maturation-associated protein) | EBI-6253688 | 0.43 |
O00459 | Phosphatidylinositol 3-kinase regulatory subunit beta (PI3-kinase regulatory subunit beta) (PI3K regulatory subunit beta) (PtdIns-3-kinase regulatory subunit beta) (Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta) (PI3-kinase subunit p85-beta) (PtdIns-3-kinase regulatory subunit p85-beta) | EBI-6256917 | 0.35 |
Q92569 | Phosphatidylinositol 3-kinase regulatory subunit gamma (PI3-kinase regulatory subunit gamma) (PI3K regulatory subunit gamma) (PtdIns-3-kinase regulatory subunit gamma) (Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma) (PI3-kinase subunit p55-gamma) (PtdIns-3-kinase regulatory subunit p55-gamma) (p55PIK) | EBI-6256917 | 0.62 |
Q8NF50 | Dedicator of cytokinesis protein 8 | EBI-6390168 | 0.40 |
P31749 | RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha) | EBI-6590127 | 0.27 |
P46108 | Adapter molecule crk (Proto-oncogene c-Crk) (p38) | EBI-6600082 | 0.27 |
Q8NFZ0 | F-box DNA helicase 1 (hFBH1) (EC 3.6.4.12) (F-box only protein 18) | EBI-6914350 | 0.40 |
P05062 | Fructose-bisphosphate aldolase B (EC 4.1.2.13) (Liver-type aldolase) | EBI-9001545 | 0.37 |
Q14032 | Bile acid-CoA:amino acid N-acyltransferase (BACAT) (BAT) (EC 2.3.1.65) (Bile acid-CoA thioesterase) (Choloyl-CoA hydrolase) (EC 3.1.2.27) (Glycine N-choloyltransferase) (Long-chain fatty-acyl-CoA hydrolase) (EC 3.1.2.2) | EBI-9001558 | 0.37 |
Q9BU70 | tRNA (adenine(37)-N6)-methyltransferase (EC 2.1.1.-) (tRNA methyltransferase O) | EBI-9001571 | 0.37 |
O60911 | Cathepsin L2 (EC 3.4.22.43) (Cathepsin U) (Cathepsin V) | EBI-9001584 | 0.37 |
Q00597 | Fanconi anemia group C protein (Protein FACC) | EBI-9001597 | 0.37 |
O00757 | Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase) | EBI-9001610 | 0.37 |
Q8IXK2 | Polypeptide N-acetylgalactosaminyltransferase 12 (EC 2.4.1.41) (Polypeptide GalNAc transferase 12) (GalNAc-T12) (pp-GaNTase 12) (Protein-UDP acetylgalactosaminyltransferase 12) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12) | EBI-9001623 | 0.37 |
Q9BXL5 | Hemogen (Erythroid differentiation-associated gene protein) (EDAG-1) (Hemopoietic gene protein) (Negative differentiation regulator protein) | EBI-9001636 | 0.37 |
Q9P1Z9 | Coiled-coil domain-containing protein 180 | EBI-9001649 | 0.37 |
Q02750 | Dual specificity mitogen-activated protein kinase kinase 1 (MAP kinase kinase 1) (MAPKK 1) (MKK1) (EC 2.7.12.2) (ERK activator kinase 1) (MAPK/ERK kinase 1) (MEK 1) | EBI-9001662 | 0.37 |
Q16644 | MAP kinase-activated protein kinase 3 (MAPK-activated protein kinase 3) (MAPKAP kinase 3) (MAPKAP-K3) (MAPKAPK-3) (MK-3) (EC 2.7.11.1) (Chromosome 3p kinase) (3pK) | EBI-9001675 | 0.37 |
Q9NR45 | Sialic acid synthase (N-acetylneuraminate synthase) (EC 2.5.1.56) (N-acetylneuraminate-9-phosphate synthase) (EC 2.5.1.57) (N-acetylneuraminic acid phosphate synthase) (N-acetylneuraminic acid synthase) | EBI-9001688 | 0.37 |
P62714 | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PP2A-beta) (EC 3.1.3.16) | EBI-9001701 | 0.37 |
P56962 | Syntaxin-17 | EBI-9001714 | 0.37 |
P23025 | DNA repair protein complementing XP-A cells (Xeroderma pigmentosum group A-complementing protein) | EBI-9001727 | 0.37 |
O75820 | Zinc finger protein 189 | EBI-9001740 | 0.37 |
P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | EBI-9451123 | 0.44 |
Q13480 | GRB2-associated-binding protein 1 (GRB2-associated binder 1) (Growth factor receptor bound protein 2-associated protein 1) | EBI-9456279 | 0.44 |
P10721 | Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117) | EBI-9464893 | 0.44 |
P14921 | Protein C-ets-1 (p54) | EBI-9698851 | 0.44 |
Q9H3M7 | Thioredoxin-interacting protein (Thioredoxin-binding protein 2) (Vitamin D3 up-regulated protein 1) | EBI-11686298 | 0.44 |
P06401 | Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3) | EBI-12590606 | 0.44 |
P19367 | Hexokinase-1 (EC 2.7.1.1) (Brain form hexokinase) (Hexokinase type I) (HK I) (Hexokinase-A) | EBI-14988411 | 0.52 |
Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
Q96QD9 | UAP56-interacting factor (Forty-two-three domain-containing protein 1) (Protein 40-2-3) | EBI-21501187 | 0.35 |
Q13503 | Mediator of RNA polymerase II transcription subunit 21 (Mediator complex subunit 21) (RNA polymerase II holoenzyme component SRB7) (RNAPII complex component SRB7) (hSrb7) | EBI-21501670 | 0.35 |
P21453 | Sphingosine 1-phosphate receptor 1 (S1P receptor 1) (S1P1) (Endothelial differentiation G-protein coupled receptor 1) (Sphingosine 1-phosphate receptor Edg-1) (S1P receptor Edg-1) (CD antigen CD363) | EBI-21539478 | 0.35 |
P42677 | 40S ribosomal protein S27 (Metallopan-stimulin 1) (MPS-1) (Small ribosomal subunit protein eS27) | EBI-21539860 | 0.35 |
P09067 | Homeobox protein Hox-B5 (Homeobox protein HHO.C10) (Homeobox protein Hox-2A) (Homeobox protein Hu-1) | EBI-21543288 | 0.35 |
O95136 | Sphingosine 1-phosphate receptor 2 (S1P receptor 2) (S1P2) (Endothelial differentiation G-protein coupled receptor 5) (Sphingosine 1-phosphate receptor Edg-5) (S1P receptor Edg-5) | EBI-21551126 | 0.35 |
Q8N5S1 | Mitochondrial carrier protein SCaMC-3L (Mitochondrial ATP-Mg/Pi carrier protein SLC25A41) (Small calcium-binding mitochondrial carrier protein 3-like) (SCaMC-3-like) (SCaMC-3L) (Solute carrier family 25 member 41) | EBI-21587332 | 0.35 |
O75626 | PR domain zinc finger protein 1 (EC 2.1.1.-) (BLIMP-1) (Beta-interferon gene positive regulatory domain I-binding factor) (PR domain-containing protein 1) (Positive regulatory domain I-binding factor 1) (PRDI-BF1) (PRDI-binding factor 1) | EBI-21603026 | 0.35 |
P21580 | Tumor necrosis factor alpha-induced protein 3 (TNF alpha-induced protein 3) (EC 2.3.2.-) (EC 3.4.19.12) (OTU domain-containing protein 7C) (Putative DNA-binding protein A20) (Zinc finger protein A20) [Cleaved into: A20p50; A20p37] | EBI-21620094 | 0.35 |
Q96SQ9 | Cytochrome P450 2S1 (EC 1.14.14.-) (CYPIIS1) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152) (Thromboxane-A synthase) (EC 5.3.99.5) | EBI-21623270 | 0.35 |
P25963 | NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) | EBI-21664926 | 0.35 |
Q6QAJ8 | Transmembrane protein 220 | EBI-21691086 | 0.35 |
Q9BTV5 | Fibronectin type III and SPRY domain-containing protein 1 (MID1-related protein 1) (Microtubule-associated protein GLFND) | EBI-21692187 | 0.35 |
Q92845 | Kinesin-associated protein 3 (KAP-3) (KAP3) (Smg GDS-associated protein) | EBI-21702814 | 0.35 |
Q96S94 | Cyclin-L2 (Paneth cell-enhanced expression protein) | EBI-21750627 | 0.35 |
Q8NFB2 | Transmembrane protein 185A (Protein FAM11A) | EBI-21757603 | 0.35 |
P49326 | Flavin-containing monooxygenase 5 (FMO 5) (Baeyer-Villiger monooxygenase 1) (hBVMO1) (EC 1.14.13.-) (Dimethylaniline monooxygenase [N-oxide-forming] 5) (EC 1.14.13.8) (Dimethylaniline oxidase 5) (NADPH oxidase) (EC 1.6.3.1) | EBI-21774649 | 0.35 |
Q86Z23 | Complement C1q-like protein 4 (C1q and tumor necrosis factor-related protein 11) (C1q/TNF-related protein 11) | EBI-21814288 | 0.35 |
Q9Y277 | Voltage-dependent anion-selective channel protein 3 (VDAC-3) (hVDAC3) (Outer mitochondrial membrane protein porin 3) | EBI-21825091 | 0.35 |
Q9UN70 | Protocadherin gamma-C3 (PCDH-gamma-C3) (Protocadherin-2) (Protocadherin-43) (PC-43) | EBI-21824946 | 0.35 |
Q6P158 | Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57) | EBI-21831097 | 0.35 |
Q8N6N7 | Acyl-CoA-binding domain-containing protein 7 | EBI-21832308 | 0.35 |
Q8WUY3 | Protein prune homolog 2 (BNIP2 motif-containing molecule at the C-terminal region 1) | EBI-21832277 | 0.35 |
Q8N165 | Serine/threonine-protein kinase PDIK1L (EC 2.7.11.1) (PDLIM1-interacting kinase 1-like) | EBI-21836274 | 0.35 |
Q92542 | Nicastrin | EBI-21836991 | 0.35 |
Q3KPI0 | Carcinoembryonic antigen-related cell adhesion molecule 21 | EBI-21837817 | 0.35 |
Q9UBH0 | Interleukin-36 receptor antagonist protein (IL-36Ra) (FIL1 delta) (IL-1-related protein 3) (IL-1RP3) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 receptor antagonist homolog 1) (IL-1ra homolog 1) (Interleukin-1-like protein 1) (IL-1L1) | EBI-21842113 | 0.35 |
Q9BYJ1 | Hydroperoxide isomerase ALOXE3 (Epidermis-type lipoxygenase 3) (Epidermal LOX-3) (e-LOX-3) (eLOX-3) (Hydroperoxy dehydratase ALOXE3) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152) (Hydroperoxy icosatetraenoate isomerase) (EC 5.4.4.7) | EBI-21843741 | 0.35 |
P15260 | Interferon gamma receptor 1 (IFN-gamma receptor 1) (IFN-gamma-R1) (CDw119) (Interferon gamma receptor alpha-chain) (IFN-gamma-R-alpha) (CD antigen CD119) | EBI-21848322 | 0.35 |
O76003 | Glutaredoxin-3 (PKC-interacting cousin of thioredoxin) (PICOT) (PKC-theta-interacting protein) (PKCq-interacting protein) (Thioredoxin-like protein 2) | EBI-21849210 | 0.35 |
Q99808 | Equilibrative nucleoside transporter 1 (Equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter) (Equilibrative NBMPR-sensitive nucleoside transporter) (Nucleoside transporter, es-type) (Solute carrier family 29 member 1) | EBI-21849345 | 0.35 |
Q96AZ6 | Interferon-stimulated gene 20 kDa protein (EC 3.1.13.1) (Estrogen-regulated transcript 45 protein) (Promyelocytic leukemia nuclear body-associated protein ISG20) | EBI-21849278 | 0.35 |
P14854 | Cytochrome c oxidase subunit 6B1 (Cytochrome c oxidase subunit VIb isoform 1) (COX VIb-1) | EBI-21849241 | 0.35 |
P49407 | Beta-arrestin-1 (Arrestin beta-1) (Non-visual arrestin-2) | EBI-15565377 | 0.62 |
P35408 | Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor) | EBI-15565467 | 0.40 |
P78536 | Disintegrin and metalloproteinase domain-containing protein 17 (ADAM 17) (EC 3.4.24.86) (Snake venom-like protease) (TNF-alpha convertase) (TNF-alpha-converting enzyme) (CD antigen CD156b) | EBI-15581054 | 0.40 |
P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-15591551 | 0.67 |
Q96AQ6 | Pre-B-cell leukemia transcription factor-interacting protein 1 (Hematopoietic PBX-interacting protein) | EBI-15606312 | 0.35 |
Q60598 | Src substrate cortactin | EBI-15645629 | 0.44 |
O00560 | Syntenin-1 (Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1) | EBI-15731494 | 0.40 |
P32121 | Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3) | EBI-15749890 | 0.56 |
P25101 | Endothelin-1 receptor (Endothelin receptor type A) (ET-A) (ETA-R) (hET-AR) | EBI-15756430 | 0.40 |
P29066 | Beta-arrestin-1 (Arrestin beta-1) | EBI-15756483 | 0.40 |
P35222 | Catenin beta-1 (Beta-catenin) | EBI-15951997 | 0.54 |
P29353 | SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1) | EBI-16183922 | 0.44 |
Q01968 | Inositol polyphosphate 5-phosphatase OCRL (EC 3.1.3.36) (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase OCRL-1) (OCRL-1) (Lowe oculocerebrorenal syndrome protein) (Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase) (EC 3.1.3.86) | EBI-16412116 | 0.35 |
Q08345 | Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a) | EBI-22053903 | 0.35 |
Q6NYC1 | Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 (EC 1.14.11.-) (Histone arginine demethylase JMJD6) (JmjC domain-containing protein 6) (Jumonji domain-containing protein 6) (Lysyl-hydroxylase JMJD6) (Peptide-lysine 5-dioxygenase JMJD6) (Phosphatidylserine receptor) (Protein PTDSR) | EBI-16745030 | 0.35 |
Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | EBI-21225038 | 0.56 |
O60551 | Glycylpeptide N-tetradecanoyltransferase 2 (EC 2.3.1.97) (Myristoyl-CoA:protein N-myristoyltransferase 2) (NMT 2) (Peptide N-myristoyltransferase 2) (Protein-lysine myristoyltransferase NMT2) (EC 2.3.1.-) (Type II N-myristoyltransferase) | EBI-21226608 | 0.44 |
Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2) | EBI-20982927 | 0.37 |
O14672 | Disintegrin and metalloproteinase domain-containing protein 10 (ADAM 10) (EC 3.4.24.81) (CDw156) (Kuzbanian protein homolog) (Mammalian disintegrin-metalloprotease) (CD antigen CD156c) | EBI-21223655 | 0.54 |
P78325 | Disintegrin and metalloproteinase domain-containing protein 8 (ADAM 8) (EC 3.4.24.-) (Cell surface antigen MS2) (CD antigen CD156a) | EBI-21225676 | 0.44 |
O43184 | Disintegrin and metalloproteinase domain-containing protein 12 (ADAM 12) (EC 3.4.24.-) (Meltrin-alpha) | EBI-21225905 | 0.56 |
Q9H013 | Disintegrin and metalloproteinase domain-containing protein 19 (ADAM 19) (EC 3.4.24.-) (Meltrin-beta) (Metalloprotease and disintegrin dendritic antigen marker) (MADDAM) | EBI-21226684 | 0.44 |
Q62985 | SH2B adapter protein 1 (FceRI gamma-chain-interacting protein SH2-B) (SH2 domain-containing protein 1B) (SH2-B PH domain-containing signaling mediator 1) | EBI-22249049 | 0.35 |
Q9Z2F5 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) (50 kDa BFA-dependent ADP-ribosylation substrate) (BARS-50) (C-terminal-binding protein 3) (CtBP3) | EBI-22249049 | 0.35 |
Q68FX8 | Mitochondrial-processing peptidase subunit alpha (Alpha-MPP) (Inactive zinc metalloprotease alpha) | EBI-22249049 | 0.35 |
Q9QZC5 | Growth factor receptor-bound protein 7 (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein) | EBI-22249049 | 0.35 |
P10634 | Cytochrome P450 2D26 (EC 1.14.14.1) (CYPIID26) (Cytochrome P450-CMF2) (Cytochrome P450-DB2) (Debrisoquine 4-hydroxylase) | EBI-22249049 | 0.35 |
A0A0G2K064 | Tyrosine-protein phosphatase non-receptor type (EC 3.1.3.48) | EBI-22249049 | 0.35 |
B2GV53 | Slc25a32 protein (Solute carrier family 25 member 32) (Solute carrier family 25, member 32 (Predicted)) | EBI-22249049 | 0.35 |
Q6AYR1 | RCG52996, isoform CRA_a (Trk-fused protein) | EBI-22249049 | 0.35 |
Q5XI60 | Receptor expression-enhancing protein 6 (Polyposis locus protein 1-like 1) | EBI-22249049 | 0.35 |
P62744 | AP-2 complex subunit sigma (Adaptor protein complex AP-2 subunit sigma) (Adaptor-related protein complex 2 subunit sigma) (Clathrin assembly protein 2 sigma small chain) (Clathrin coat assembly protein AP17) (Clathrin coat-associated protein AP17) (Plasma membrane adaptor AP-2 17 kDa protein) (Sigma-adaptin 3b) (Sigma2-adaptin) | EBI-22261657 | 0.35 |
Q68FS2 | COP9 signalosome complex subunit 4 (SGN4) (Signalosome subunit 4) (JAB1-containing signalosome subunit 4) | EBI-22261657 | 0.35 |
P61621 | Protein transport protein Sec61 subunit alpha isoform 1 (Sec61 alpha-1) | EBI-22261657 | 0.35 |
F1M062 | La ribonucleoprotein 1, translational regulator | EBI-22261657 | 0.35 |
F1M5N4 | Malic enzyme | EBI-22261657 | 0.35 |
D3ZIL6 | Enoyl CoA hydratase domain-containing 2 (Enoyl Coenzyme A hydratase domain containing 2 (Predicted), isoform CRA_a) | EBI-22261657 | 0.35 |
Q10758 | Keratin, type II cytoskeletal 8 (Cytokeratin endo A) (Cytokeratin-8) (CK-8) (Keratin-8) (K8) (Type-II keratin Kb8) | EBI-22261657 | 0.35 |
A0A0G2K261 | Isoleucine--tRNA ligase (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) | EBI-22261657 | 0.35 |
Q5BK57 | HAUS augmin-like complex subunit 8 (HEC1/NDC80-interacting centrosome-associated protein 1) (Sarcoma antigen NY-SAR-48 homolog) | EBI-22261657 | 0.35 |
P54001 | Prolyl 4-hydroxylase subunit alpha-1 (4-PH alpha-1) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1) | EBI-22261657 | 0.35 |
P21816 | Cysteine dioxygenase type 1 (EC 1.13.11.20) (Cysteine dioxygenase type I) (CDO) (CDO-I) | EBI-22261657 | 0.35 |
Q5M8C3 | Serine (Or cysteine) proteinase inhibitor, clade A (Alpha-1 antiproteinase, antitrypsin), member 4 (Serine (Or cysteine) proteinase inhibitor, clade A (Alpha-1 antiproteinase, antitrypsin), member 4, isoform CRA_a) (Serpin family A member 4) | EBI-22261657 | 0.35 |
P11466 | Peroxisomal carnitine O-octanoyltransferase (COT) (EC 2.3.1.137) | EBI-22261657 | 0.35 |
Q6AYC9 | Ankyrin repeat and SOCS box-containing 6 | EBI-22261657 | 0.35 |
A0A8I6AI13 | Hemoglobin alpha, adult chain 1 | EBI-22261657 | 0.35 |
P62902 | 60S ribosomal protein L31 | EBI-22261657 | 0.35 |
D3ZLE6 | RT1 class I, CE7 | EBI-22261657 | 0.35 |
D4A3Q2 | Stromal antigen 1 (Stromal antigen 1 (Predicted), isoform CRA_a) | EBI-22261657 | 0.35 |
F1LQH2 | Nuclear factor NF-kappa-B p105 subunit (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) | EBI-22261657 | 0.35 |
F1LM66 | 116 kDa U5 small nuclear ribonucleoprotein component (U5 snRNP-specific protein, 116 kDa) | EBI-22261657 | 0.35 |
A0A096MJZ8 | [Histone H3]-trimethyl-L-lysine(4) demethylase (EC 1.14.11.67) | EBI-22261657 | 0.35 |
D3ZKR8 | Protein kish | EBI-22261657 | 0.35 |
Q63279 | Keratin, type I cytoskeletal 19 (Cytokeratin-19) (CK-19) (Keratin-19) (K19) (Type I keratin Ka19) | EBI-22261657 | 0.35 |
B5DEH4 | UDP-N-acetylglucosamine pyrophosphorylase 1-like 1 (Uap1l1 protein) | EBI-22261657 | 0.35 |
F1M951 | Tyrosine-protein phosphatase non-receptor type 23 | EBI-22261657 | 0.35 |
F1LM93 | Tyrosine-protein kinase Yes (EC 2.7.10.2) (p61-Yes) | EBI-22261657 | 0.35 |
D3ZYG0 | Vav guanine nucleotide exchange factor 2 | EBI-22261657 | 0.35 |
Q06884 | Cytochrome P450 3A (EC 1.14.14.-) | EBI-22261657 | 0.35 |
B2GUV7 | Eukaryotic translation initiation factor 5B (eIF-5B) (EC 3.6.5.3) (Annexin V-binding protein ABP-7) (Translation initiation factor IF-2) | EBI-22261657 | 0.35 |
Q8K4V4 | Sorting nexin-27 (MAP-responsive gene protein) (Methamphetamine-responsive transcript 1 protein) (PDZ-protein Mrt1) | EBI-22261657 | 0.35 |
P25030 | Keratin, type I cytoskeletal 20 (Cytokeratin-20) (CK-20) (Cytokeratin-21) (CK-21) (Keratin-20) (K20) | EBI-22261657 | 0.35 |
Q5RKG9 | Eukaryotic translation initiation factor 4B | EBI-22261657 | 0.35 |
D3ZQ63 | tRNA N(3)-methylcytidine methyltransferase (EC 2.1.1.-) | EBI-22261657 | 0.35 |
F1M0R1 | Ring finger protein 213 | EBI-22261657 | 0.35 |
B2RYD7 | Dolichyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.18) | EBI-22261657 | 0.35 |
D3ZDP2 | Mitochondrial ribosomal protein L58 | EBI-22261657 | 0.35 |
F1LNL3 | ATP-binding cassette subfamily A member 1 | EBI-22261657 | 0.35 |
Q66HR0 | Solute carrier family 12 member 9 (Cation-chloride cotransporter 6) | EBI-22261657 | 0.35 |
P00176 | Cytochrome P450 2B1 (EC 1.14.14.1) (CYPIIB1) (Cytochrome P450-B) (Cytochrome P450b) (Cytochrome P450-LM2) (Cytochrome P450-PB1) (Cytochrome P450-PB2) | EBI-22261657 | 0.35 |
Q63186 | Translation initiation factor eIF-2B subunit delta (eIF-2B GDP-GTP exchange factor subunit delta) | EBI-22261657 | 0.35 |
Q499Q3 | Interferon-induced GTP-binding protein Mx2 (Myxovirus (Influenza virus) resistance 2) (RCG53028) | EBI-22261657 | 0.35 |
Q5PQL2 | CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd-1) | EBI-22261657 | 0.35 |
A0A0A0MY43 | Activating signal cointegrator 1 complex subunit 3 | EBI-22261657 | 0.35 |
Q4QQT3 | CUGBP Elav-like family member 1 (CELF-1) (Bruno-like protein 2) (CUG triplet repeat RNA-binding protein 1) (CUG-BP1) (CUG-BP- and ETR-3-like factor 1) (RNA-binding protein BRUNOL-2) | EBI-22261657 | 0.35 |
G3V781 | Double-strand break repair protein | EBI-22261657 | 0.35 |
Q5RKH0 | Cytokine-like nuclear factor N-PAC (NPAC) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Putative oxidoreductase GLYR1) | EBI-22261657 | 0.35 |
M0R671 | Tensin 2 | EBI-22261657 | 0.35 |
D3ZMS1 | Splicing factor 3b, subunit 2 (Splicing factor 3b, subunit 2 (Predicted), isoform CRA_a) | EBI-22261657 | 0.35 |
O08662 | Phosphatidylinositol 4-kinase alpha (PI4-kinase alpha) (PI4K-alpha) (PtdIns-4-kinase alpha) (EC 2.7.1.67) | EBI-22261657 | 0.35 |
D3ZJ01 | RAB11-binding and LisH domain, coiled-coil and HEAT repeat-containing (Similar to RIKEN cDNA 2310035C23 (Predicted)) | EBI-22261657 | 0.35 |
Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-22297428 | 0.62 |
O60783 | 28S ribosomal protein S14, mitochondrial (MRP-S14) (S14mt) (Mitochondrial small ribosomal subunit protein uS14m) | EBI-25384369 | 0.35 |
P07437 | Tubulin beta chain (Tubulin beta-5 chain) | EBI-25384369 | 0.35 |
P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-25384369 | 0.53 |
P11021 | Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein) (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein) | EBI-25384369 | 0.35 |
P11940 | Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1) | EBI-25384369 | 0.35 |
Q9H361 | Polyadenylate-binding protein 3 (PABP-3) (Poly(A)-binding protein 3) (Testis-specific poly(A)-binding protein) | EBI-25384369 | 0.35 |
P40939 | Trifunctional enzyme subunit alpha, mitochondrial (78 kDa gastrin-binding protein) (Monolysocardiolipin acyltransferase) (EC 2.3.1.-) (TP-alpha) [Includes: Long-chain enoyl-CoA hydratase (EC 4.2.1.17); Long chain 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.211)] | EBI-25384369 | 0.35 |
P67936 | Tropomyosin alpha-4 chain (TM30p1) (Tropomyosin-4) | EBI-25384369 | 0.35 |
P06753 | Tropomyosin alpha-3 chain (Gamma-tropomyosin) (Tropomyosin-3) (Tropomyosin-5) (hTM5) | EBI-25384369 | 0.35 |
P82650 | 28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22) | EBI-25384369 | 0.35 |
P82914 | 28S ribosomal protein S15, mitochondrial (MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m) | EBI-25384369 | 0.35 |
Q00325 | Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) | EBI-25384369 | 0.35 |
Q00341 | Vigilin (High density lipoprotein-binding protein) (HDL-binding protein) | EBI-25384369 | 0.35 |
Q13310 | Polyadenylate-binding protein 4 (PABP-4) (Poly(A)-binding protein 4) (Activated-platelet protein 1) (APP-1) (Inducible poly(A)-binding protein) (iPABP) | EBI-25384369 | 0.35 |
Q15366 | Poly(rC)-binding protein 2 (Alpha-CP2) (Heterogeneous nuclear ribonucleoprotein E2) (hnRNP E2) | EBI-25384369 | 0.35 |
P57721 | Poly(rC)-binding protein 3 (Alpha-CP3) (PCBP3-overlapping transcript) (PCBP3-overlapping transcript 1) | EBI-25384369 | 0.35 |
Q71RC2 | La-related protein 4 (La ribonucleoprotein domain family member 4) | EBI-25384369 | 0.35 |
Q99700 | Ataxin-2 (Spinocerebellar ataxia type 2 protein) (Trinucleotide repeat-containing gene 13 protein) | EBI-25384369 | 0.35 |
Q9Y291 | 28S ribosomal protein S33, mitochondrial (MRP-S33) (S33mt) (Mitochondrial small ribosomal subunit protein mS33) | EBI-25384369 | 0.35 |
Q9Y2R9 | 28S ribosomal protein S7, mitochondrial (MRP-S7) (S7mt) (Mitochondrial small ribosomal subunit protein uS7m) (bMRP-27a) (bMRP27a) | EBI-25384369 | 0.35 |
O60306 | RNA helicase aquarius (EC 3.6.4.13) (Intron-binding protein of 160 kDa) (IBP160) | EBI-25384369 | 0.35 |
P07910 | Heterogeneous nuclear ribonucleoproteins C1/C2 (hnRNP C1/C2) | EBI-25384369 | 0.35 |
P09651 | Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed] | EBI-25384369 | 0.35 |
Q32P51 | Heterogeneous nuclear ribonucleoprotein A1-like 2 (hnRNP A1-like 2) (hnRNP core protein A1-like 2) | EBI-25384369 | 0.35 |
P11142 | Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1) | EBI-25384369 | 0.35 |
P12236 | ADP/ATP translocase 3 (ADP,ATP carrier protein 3) (ADP,ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6) [Cleaved into: ADP/ATP translocase 3, N-terminally processed] | EBI-25384369 | 0.35 |
P27708 | CAD protein [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] | EBI-25384369 | 0.35 |
P33993 | DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1-MCM3) | EBI-25384369 | 0.35 |
P34932 | Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70-related protein APG-2) | EBI-25384369 | 0.35 |
P38646 | Stress-70 protein, mitochondrial (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Mortalin) (MOT) (Peptide-binding protein 74) (PBP74) | EBI-25384369 | 0.35 |
P63313 | Thymosin beta-10 | EBI-25384369 | 0.35 |
P68363 | Tubulin alpha-1B chain (EC 3.6.5.-) (Alpha-tubulin ubiquitous) (Tubulin K-alpha-1) (Tubulin alpha-ubiquitous chain) [Cleaved into: Detyrosinated tubulin alpha-1B chain] | EBI-25384369 | 0.35 |
P68366 | Tubulin alpha-4A chain (EC 3.6.5.-) (Alpha-tubulin 1) (Testis-specific alpha-tubulin) (Tubulin H2-alpha) (Tubulin alpha-1 chain) | EBI-25384369 | 0.35 |
Q8NEV1 | Casein kinase II subunit alpha 3 (CK II alpha 3) (EC 2.7.11.1) (Casein kinase II alpha 1 polypeptide pseudogene) | EBI-25384369 | 0.35 |
Q01081 | Splicing factor U2AF 35 kDa subunit (U2 auxiliary factor 35 kDa subunit) (U2 small nuclear RNA auxiliary factor 1) (U2 snRNP auxiliary factor small subunit) | EBI-25384369 | 0.35 |
Q02952 | A-kinase anchor protein 12 (AKAP-12) (A-kinase anchor protein 250 kDa) (AKAP 250) (Gravin) (Myasthenia gravis autoantigen) | EBI-25384369 | 0.35 |
Q13151 | Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) | EBI-25384369 | 0.35 |
Q13263 | Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin transferase TIF1-beta) (Tripartite motif-containing protein 28) | EBI-25384369 | 0.35 |
Q14839 | Chromodomain-helicase-DNA-binding protein 4 (CHD-4) (EC 3.6.4.12) (ATP-dependent helicase CHD4) (Mi-2 autoantigen 218 kDa protein) (Mi2-beta) | EBI-25384369 | 0.35 |
Q15370 | Elongin-B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2) | EBI-25384369 | 0.35 |
Q8N163 | Cell cycle and apoptosis regulator protein 2 (Cell division cycle and apoptosis regulator protein 2) (DBIRD complex subunit KIAA1967) (Deleted in breast cancer gene 1 protein) (DBC-1) (DBC.1) (NET35) (p30 DBC) | EBI-25384369 | 0.35 |
Q92598 | Heat shock protein 105 kDa (Antigen NY-CO-25) (Heat shock 110 kDa protein) | EBI-25384369 | 0.35 |
Q93009 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-25384369 | 0.35 |
P05387 | 60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY-REN-44) | EBI-25394988 | 0.35 |
Q12904 | Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (Multisynthase complex auxiliary component p43) [Cleaved into: Endothelial monocyte-activating polypeptide 2 (EMAP-2) (Endothelial monocyte-activating polypeptide II) (EMAP-II) (Small inducible cytokine subfamily E member 1)] | EBI-25394988 | 0.35 |
Q15046 | Lysine--tRNA ligase (EC 2.7.7.-) (EC 6.1.1.6) (Lysyl-tRNA synthetase) (LysRS) | EBI-25394988 | 0.35 |
O60264 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5) (EC 3.6.4.-) (Sucrose nonfermenting protein 2 homolog) (hSNF2H) | EBI-25394988 | 0.35 |
P28370 | Probable global transcription activator SNF2L1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA1) (Nucleosome-remodeling factor subunit SNF2L) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 1) | EBI-25394988 | 0.35 |
Q6XD76 | Achaete-scute homolog 4 (ASH-4) (hASH4) (Achaete-scute-like protein 4) (Class A basic helix-loop-helix protein 44) (bHLHa44) | EBI-25892220 | 0.56 |
O14796 | SH2 domain-containing protein 1B (EWS/FLI1-activated transcript 2) (EAT-2) | EBI-25892212 | 0.56 |
Q9UIH9 | Krueppel-like factor 15 (Kidney-enriched krueppel-like factor) | EBI-25892204 | 0.56 |
Q15907 | Ras-related protein Rab-11B (EC 3.6.5.2) (GTP-binding protein YPT3) | EBI-25892188 | 0.56 |
Q14457 | Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa] | EBI-25892180 | 0.56 |
Q9UNY5 | Zinc finger protein 232 (Zinc finger and SCAN domain-containing protein 11) | EBI-25892172 | 0.56 |
Q13829 | BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (hBACURD2) (BTB/POZ domain-containing protein TNFAIP1) (Protein B12) (Tumor necrosis factor, alpha-induced protein 1, endothelial) | EBI-25892164 | 0.56 |
O60880 | SH2 domain-containing protein 1A (Duncan disease SH2-protein) (Signaling lymphocytic activation molecule-associated protein) (SLAM-associated protein) (T-cell signal transduction molecule SAP) | EBI-25892148 | 0.56 |
Q13322 | Growth factor receptor-bound protein 10 (GRB10 adapter protein) (Insulin receptor-binding protein Grb-IR) | EBI-25892138 | 0.56 |
P01116 | GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed] | EBI-27041844 | 0.27 |
P01111 | GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras) | EBI-27042293 | 0.27 |
F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
P63252 | Inward rectifier potassium channel 2 (Cardiac inward rectifier potassium channel) (Inward rectifier K(+) channel Kir2.1) (IRK-1) (hIRK1) (Potassium channel, inwardly rectifying subfamily J member 2) | EBI-28956128 | 0.27 |
P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-27084109 | 0.35 |
Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
P07947 | Tyrosine-protein kinase Yes (EC 2.7.10.2) (Proto-oncogene c-Yes) (p61-Yes) | EBI-28931668 | 0.35 |
P08631 | Tyrosine-protein kinase HCK (EC 2.7.10.2) (Hematopoietic cell kinase) (Hemopoietic cell kinase) (p59-HCK/p60-HCK) (p59Hck) (p61Hck) | EBI-28931703 | 0.35 |
Q05513 | Protein kinase C zeta type (EC 2.7.11.13) (nPKC-zeta) | EBI-28931938 | 0.35 |
P09769 | Tyrosine-protein kinase Fgr (EC 2.7.10.2) (Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog) (Proto-oncogene c-Fgr) (p55-Fgr) (p58-Fgr) (p58c-Fgr) | EBI-28931938 | 0.35 |
P06239 | Tyrosine-protein kinase Lck (EC 2.7.10.2) (Leukocyte C-terminal Src kinase) (LSK) (Lymphocyte cell-specific protein-tyrosine kinase) (Protein YT16) (Proto-oncogene Lck) (T cell-specific protein-tyrosine kinase) (p56-LCK) | EBI-28931938 | 0.35 |
P05090 | Apolipoprotein D (Apo-D) (ApoD) | EBI-28931938 | 0.35 |
O00170 | AH receptor-interacting protein (AIP) (Aryl-hydrocarbon receptor-interacting protein) (HBV X-associated protein 2) (XAP-2) (Immunophilin homolog ARA9) | EBI-28931938 | 0.35 |
Q86V86 | Serine/threonine-protein kinase pim-3 (EC 2.7.11.1) | EBI-28942203 | 0.35 |
Q8TEA7 | TBC domain-containing protein kinase-like protein | EBI-28943849 | 0.35 |
P42566 | Epidermal growth factor receptor substrate 15 (Protein Eps15) (Protein AF-1p) | EBI-30822769 | 0.44 |
Database | Links |
UNIPROT | P12931 E1P5V4 Q76P87 Q86VB9 Q9H5A8 |
PDB | 1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ 4F59 4F5A 4F5B 4HXJ 4K11 4MXO 4MXX 4MXY 4MXZ 6ATE 6C4S 6E6E 6EHJ 7NG7 |
Pfam | PF07714 PF00017 PF00018 |
PROSITE | PS00107 PS50011 PS00109 PS50001 PS50002 |
OMIM | 190090 616937 |
DisGeNET | 6714 |