Protein Information |
|
|---|---|
| Protein Name | C-Jun-amino-terminal kinase-interacting protein 4 |
| Accession Code | O60271 |
| Gene | SPAG9 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1321) | |
|
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRD DNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALH QRHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSRIRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQP RSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPASTANSDVATIPTDTPLKEENEGFVKVTDAPNKSEISKHIEVQ VAQETRNVSTGSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEG ADLLGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEA EDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLF SSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKED GRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLD TEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPG ARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSE VDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVRE EAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHL LDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTY QHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENSDK VTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKSMLVISGGEGYID FRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGNE |
|
Structure Viewer (PDB: 2W83) |
|---|
Description |
||
|---|---|---|
| Cytoplasm {By SimilarityUniProtKB:Q58A65}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q58A65}. Lysosome membrane {Experimental EvidencePubMed:29146937}. Note=Perinuclear distribution in response to stress signals such as UV radiation. {By SimilarityUniProtKB:Q58A65}. [Isoform 5]: Cytoplasmic vesicle, secretory vesicle, acrosome {ECO:0000269|PubMed:15693750}. Note=Associated with the plasma membrane of the acrosomal compartment and also localizes in the acrosome matrix. {ECO:0000269|PubMed:15693750}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Acrosomal Vesicle (GO:0001669) Centriolar Satellite (GO:0034451) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Lysosomal Membrane (GO:0005765) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Interactions with Nuclear Envelope proteins (4 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O60271 | Self | EBI-7141074 | 0.44 |
| P61026 | Ras-related protein Rab-10 | EBI-25436875 | 0.40 |
| Q00613 | Heat shock factor protein 1 | EBI-11911387 | 0.00 |
| Q9UPT6 | C-Jun-amino-terminal kinase-interacting protein 3 | EBI-21663692 | 0.35 | Interactions with other proteins (82 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P19838 | Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit] | EBI-353534 | 0.69 |
| O88447 | Kinesin light chain 1 (KLC 1) | EBI-7681059 | 0.27 |
| Q14240 | Eukaryotic initiation factor 4A-II (eIF-4A-II) (eIF4A-II) (EC 3.6.4.13) (ATP-dependent RNA helicase eIF4A-2) | EBI-1068469 | 0.00 |
| P53350 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-2372594 | 0.73 |
| Q07832 | Serine/threonine-protein kinase PLK1 (EC 2.7.11.21) (Polo-like kinase 1) (PLK-1) (Serine/threonine-protein kinase 13) (STPK13) | EBI-2560950 | 0.40 |
| Q8ZED8 | Exoribonuclease 2 (EC 3.1.13.1) (Exoribonuclease II) (RNase II) (Ribonuclease II) | EBI-2866304 | 0.00 |
| P62330 | ADP-ribosylation factor 6 (EC 3.6.5.2) | EBI-7140974 | 0.62 |
| P84077 | ADP-ribosylation factor 1 (EC 3.6.5.2) | EBI-7141242 | 0.44 |
| Q9HC52 | Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3) (hPc3) (Rectachrome 1) | EBI-3951861 | 0.35 |
| Q9GZQ8 | Microtubule-associated proteins 1A/1B light chain 3B (Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta) | EBI-7190550 | 0.37 |
| Q9NPJ4 | Proline-rich nuclear receptor coactivator 2 | EBI-7316035 | 0.37 |
| P62331 | ADP-ribosylation factor 6 (EC 3.6.5.2) | EBI-7832567 | 0.40 |
| Q96A65 | Exocyst complex component 4 (Exocyst complex component Sec8) | EBI-9817790 | 0.56 |
| P23771 | Trans-acting T-cell-specific transcription factor GATA-3 (GATA-binding factor 3) | EBI-10891010 | 0.35 |
| A3KN83 | Protein strawberry notch homolog 1 (Monocyte protein 3) (MOP-3) | EBI-11898766 | 0.00 |
| Q9UQ88 | Cyclin-dependent kinase 11A (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 2) (Cell division protein kinase 11A) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L2) | EBI-11901851 | 0.00 |
| Q9UKN8 | General transcription factor 3C polypeptide 4 (EC 2.3.1.48) (TF3C-delta) (Transcription factor IIIC 90 kDa subunit) (TFIIIC 90 kDa subunit) (TFIIIC90) (Transcription factor IIIC subunit delta) | EBI-11901842 | 0.00 |
| Q9UBC2 | Epidermal growth factor receptor substrate 15-like 1 (Eps15-related protein) (Eps15R) | EBI-11901833 | 0.00 |
| Q8WUA4 | General transcription factor 3C polypeptide 2 (TF3C-beta) (Transcription factor IIIC 110 kDa subunit) (TFIIIC 110 kDa subunit) (TFIIIC110) (Transcription factor IIIC subunit beta) | EBI-11901824 | 0.00 |
| P11274 | Breakpoint cluster region protein (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-26) | EBI-11901815 | 0.00 |
| P30291 | Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase) | EBI-11907279 | 0.00 |
| P33991 | DNA replication licensing factor MCM4 (EC 3.6.4.12) (CDC21 homolog) (P1-CDC21) | EBI-11907576 | 0.00 |
| P33993 | DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1-MCM3) | EBI-11907675 | 0.00 |
| P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | EBI-11908484 | 0.00 |
| Q06945 | Transcription factor SOX-4 | EBI-11911777 | 0.00 |
| Q12955 | Ankyrin-3 (ANK-3) (Ankyrin-G) | EBI-11912325 | 0.00 |
| Q14566 | DNA replication licensing factor MCM6 (EC 3.6.4.12) (p105MCM) | EBI-11913337 | 0.00 |
| Q14C86 | GTPase-activating protein and VPS9 domain-containing protein 1 (GAPex-5) (Rab5-activating protein 6) | EBI-11913870 | 0.00 |
| Q14683 | Structural maintenance of chromosomes protein 1A (SMC protein 1A) (SMC-1-alpha) (SMC-1A) (Sb1.8) | EBI-11913616 | 0.00 |
| Q6IN85 | Serine/threonine-protein phosphatase 4 regulatory subunit 3A (SMEK homolog 1) | EBI-11917442 | 0.00 |
| Q96BY7 | Autophagy-related protein 2 homolog B | EBI-11926258 | 0.00 |
| Q9NY27 | Serine/threonine-protein phosphatase 4 regulatory subunit 2 | EBI-11934518 | 0.00 |
| Q9P260 | RAB11-binding protein RELCH (LisH domain and HEAT repeat-containing protein KIAA1468) (RAB11 binding and LisH domain, coiled-coil and HEAT repeat-containing) (RAB11-binding protein containing LisH, coiled-coil, and HEAT repeats) | EBI-11935551 | 0.00 |
| Q9UQE7 | Structural maintenance of chromosomes protein 3 (SMC protein 3) (SMC-3) (Basement membrane-associated chondroitin proteoglycan) (Bamacan) (Chondroitin sulfate proteoglycan 6) (Chromosome-associated polypeptide) (hCAP) | EBI-11939891 | 0.00 |
| Q9Y4E8 | Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.4.19.12) (Deubiquitinating enzyme 15) (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Unph-2) (Unph4) | EBI-11941617 | 0.00 |
| Q9Y6Y0 | Influenza virus NS1A-binding protein (NS1-BP) (NS1-binding protein) (Aryl hydrocarbon receptor-associated protein 3) (Kelch-like protein 39) | EBI-11942633 | 0.00 |
| Q8TBP5 | Membrane protein FAM174A (Hepatitis C virus NS5A-transactivated protein 6) (HCV NS5A-transactivated protein 6) (Transmembrane protein 157) | EBI-21502646 | 0.35 |
| Q8N6T3 | ADP-ribosylation factor GTPase-activating protein 1 (ARF GAP 1) (ADP-ribosylation factor 1 GTPase-activating protein) (ARF1 GAP) (ARF1-directed GTPase-activating protein) | EBI-21541414 | 0.35 |
| Q9UF02 | Voltage-dependent calcium channel gamma-5 subunit (Neuronal voltage-gated calcium channel gamma-5 subunit) (Transmembrane AMPAR regulatory protein gamma-5) (TARP gamma-5) | EBI-21554221 | 0.35 |
| Q86VU5 | Catechol O-methyltransferase domain-containing protein 1 (EC 2.1.1.-) | EBI-21596714 | 0.35 |
| Q6EMK4 | Vasorin (Protein slit-like 2) | EBI-21651359 | 0.35 |
| P08247 | Synaptophysin (Major synaptic vesicle protein p38) | EBI-21652717 | 0.35 |
| Q2TBA0 | Kelch-like protein 40 (Kelch repeat and BTB domain-containing protein 5) (Sarcosynapsin) | EBI-21658220 | 0.35 |
| Q96MC5 | bMERB domain-containing protein 1 | EBI-21663233 | 0.35 |
| O96006 | E3 SUMO-protein ligase ZBED1 (EC 2.3.2.-) (DNA replication-related element-binding factor) (Putative Ac-like transposable element) (Zinc finger BED domain-containing protein 1) (dREF homolog) | EBI-21692488 | 0.35 |
| A6NED2 | RCC1 domain-containing protein 1 | EBI-21716445 | 0.35 |
| P31350 | Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) | EBI-21732275 | 0.35 |
| Q7LG56 | Ribonucleoside-diphosphate reductase subunit M2 B (EC 1.17.4.1) (TP53-inducible ribonucleotide reductase M2 B) (p53-inducible ribonucleotide reductase small subunit 2-like protein) (p53R2) | EBI-21732528 | 0.35 |
| Q8WYK0 | Acetyl-coenzyme A thioesterase (EC 3.1.2.1) (Acyl-CoA thioester hydrolase 12) (Acyl-coenzyme A thioesterase 12) (Acyl-CoA thioesterase 12) (Cytoplasmic acetyl-CoA hydrolase 1) (CACH-1) (hCACH-1) (START domain-containing protein 15) (StARD15) | EBI-21732608 | 0.35 |
| O00592 | Podocalyxin (GCTM-2 antigen) (Gp200) (Podocalyxin-like protein 1) (PC) (PCLP-1) | EBI-21750748 | 0.35 |
| Q96CA5 | Baculoviral IAP repeat-containing protein 7 (EC 2.3.2.27) (Kidney inhibitor of apoptosis protein) (KIAP) (Livin) (Melanoma inhibitor of apoptosis protein) (ML-IAP) (RING finger protein 50) (RING-type E3 ubiquitin transferase BIRC7) [Cleaved into: Baculoviral IAP repeat-containing protein 7 30kDa subunit (Truncated livin) (p30-Livin) (tLivin)] | EBI-21754959 | 0.35 |
| O14863 | Zinc transporter 4 (ZnT-4) (Solute carrier family 30 member 4) | EBI-21768088 | 0.35 |
| O95159 | Zinc finger protein-like 1 (Zinc finger protein MCG4) | EBI-21768155 | 0.35 |
| P06753 | Tropomyosin alpha-3 chain (Gamma-tropomyosin) (Tropomyosin-3) (Tropomyosin-5) (hTM5) | EBI-21768209 | 0.35 |
| P09493 | Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1) | EBI-21768262 | 0.35 |
| P16150 | Leukosialin (GPL115) (Galactoglycoprotein) (GALGP) (Leukocyte sialoglycoprotein) (Sialophorin) (CD antigen CD43) [Cleaved into: CD43 cytoplasmic tail (CD43-ct) (CD43ct)] | EBI-21768371 | 0.35 |
| Q14108 | Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36) | EBI-21768396 | 0.35 |
| Q147U7 | Single-pass membrane and coiled-coil domain-containing protein 1 (Single-pass membrane protein with coiled-coil domains 1) | EBI-21768421 | 0.35 |
| Q2T9K0 | Transmembrane protein 44 | EBI-21768445 | 0.35 |
| Q5XKK7 | Protein FAM219B | EBI-21768464 | 0.35 |
| Q8N565 | Melanoregulin (Dilute suppressor protein homolog) | EBI-21768514 | 0.35 |
| Q96L93 | Kinesin-like protein KIF16B (Sorting nexin-23) | EBI-21768545 | 0.35 |
| Q9BWT6 | Meiotic nuclear division protein 1 homolog | EBI-21768576 | 0.35 |
| Q9NWA0 | Mediator of RNA polymerase II transcription subunit 9 (Mediator complex subunit 9) | EBI-21768607 | 0.35 |
| Q9NPJ6 | Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36) | EBI-25472202 | 0.27 |
| P61006 | Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel) | EBI-21006330 | 0.62 |
| Q5NFC5 | Type II secretion system protein H (General secretion pathway protein H) | EBI-22299450 | 0.37 |
| Q5NES6 | Curli production assembly/transport component CsgG | EBI-22299440 | 0.37 |
| H9EJ66 | Non-structural protein 3 | EBI-25685143 | 0.35 |
| P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | EBI-25686340 | 0.35 |
| Q2TAZ0 | Autophagy-related protein 2 homolog A | EBI-26443127 | 0.35 |
| P22612 | cAMP-dependent protein kinase catalytic subunit gamma (PKA C-gamma) (EC 2.7.11.11) | EBI-28934688 | 0.35 |
| P36507 | Dual specificity mitogen-activated protein kinase kinase 2 (MAP kinase kinase 2) (MAPKK 2) (EC 2.7.12.2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK 2) | EBI-28935019 | 0.35 |
| P51617 | Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1) | EBI-28935882 | 0.35 |
| Q8TDX7 | Serine/threonine-protein kinase Nek7 (EC 2.7.11.1) (Never in mitosis A-related kinase 7) (NimA-related protein kinase 7) | EBI-28943744 | 0.35 |
| Q92918 | Mitogen-activated protein kinase kinase kinase kinase 1 (EC 2.7.11.1) (Hematopoietic progenitor kinase) (MAPK/ERK kinase kinase kinase 1) (MEK kinase kinase 1) (MEKKK 1) | EBI-28944233 | 0.35 |
| Q96QS6 | Serine/threonine-protein kinase H2 (EC 2.7.11.1) (Protein serine kinase H2) (PSK-H2) | EBI-28944559 | 0.35 |
| Q99502 | Eyes absent homolog 1 (EC 3.1.3.16) (EC 3.1.3.48) | EBI-27113432 | 0.35 |
| O15297 | Protein phosphatase 1D (EC 3.1.3.16) (Protein phosphatase 2C isoform delta) (PP2C-delta) (Protein phosphatase magnesium-dependent 1 delta) (p53-induced protein phosphatase 1) | EBI-27113880 | 0.35 |
| O14830 | Serine/threonine-protein phosphatase with EF-hands 2 (PPEF-2) (EC 3.1.3.16) | EBI-27113806 | 0.35 |
| Q8N3J5 | Protein phosphatase 1K, mitochondrial (EC 3.1.3.16) (PP2C domain-containing protein phosphatase 1K) (PP2C-like mitochondrial protein) (PP2C-type mitochondrial phosphoprotein phosphatase) (PTMP) (Protein phosphatase 2C isoform kappa) (PP2C-kappa) | EBI-27114011 | 0.35 |
| P56180 | Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5) | EBI-27115406 | 0.35 |
Database | Links |
| UNIPROT | O60271 A6H8U5 A8MSX0 B4DHH2 O60905 Q3KQU8 Q3MKM7 Q86WC7 Q86WC8 Q8IZX7 Q96II0 Q9H811 |
| PDB | 2W83 |
| Pfam | PF16471 PF09744 |
| PROSITE | PS51776 PS51777 |
| OMIM | 605430 |
| DisGeNET | 9043 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory