NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Dual specificity testis-specific protein kinase 1 - Mus musculus - NucEnvDB

Dual specificity testis-specific protein kinase 1 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Dual specificity testis-specific protein kinase 1
Accession Code	O70146
Gene	Tesk1
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 627)
MAGERPPLRGPGPGEAPGEGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFDCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRSNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGG TLEQLLSSPEPLSWPVRLHLALDIAQGLRYLHAKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGTRKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTE DFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSTRAPFTEITQHLEQILEQQPEATPLAKPPLTKAPLTYNQGSVPRGGPSATLPRPDPRLSRSRSDLFLPPSPESPPSWGDNLTRVNPFSLREDLRGG KIKLLDTPCKPATPLPLVPPSPLTSTQLPLVTTPDILVQPETPVRRCRSLPSSPELPRRMETALPGPGPSPMGPTEERMDCEGSSPEPEPPGLAPQLPLAVATDNFISTCSSASQPWSPRSGPPLNNNPP AVVVNSPQGWAREPWNRAQHSLPRAAALERTEPSPPPSAPREPEEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS

Subcellular Location

Description
Cytoplasm {By SimilarityUniProtKB:Q15569}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q63572}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {By SimilarityUniProtKB:Q15569}. Cell projection, lamellipodium {By SimilarityUniProtKB:Q63572}. Note=Colocalizes with SPRY4 in vesicular spots in the cytoplasm (By similarity). Localized to F-actin- rich lamellipodia at the cell periphery following fibronectin-mediated cell adhesion of Schwann cells (By similarity). {By SimilarityUniProtKB:Q15569, By SimilarityUniProtKB:Q63572}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Lamellipodium (GO:0030027) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues (By similarity). Regulates the cellular cytoskeleton by enhancing actin stress fiber formation via phosphorylation of cofilin and by preventing microtubule breakdown via inhibition of TAOK1/MARKK kinase activity (By similarity). Inhibits podocyte motility via regulation of actin cytoskeletal dynamics and phosphorylation of CFL1 (PubMed:30115939). Positively regulates integrin-mediated cell spreading, via phosphorylation of cofilin (By similarity). Suppresses ciliogenesis via multiple pathways; phosphorylation of CFL1, suppression of ciliary vesicle directional trafficking to the ciliary base, and by facilitating YAP1 nuclear localization where it acts as a transcriptional corepressor of the TEAD4 target genes AURKA and PLK1 (By similarity). Probably plays a central role at and after the meiotic phase of spermatogenesis (By similarity). {By SimilarityUniProtKB:Q15569, By SimilarityUniProtKB:Q63572, Experimental EvidencePubMed:30115939}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Establishment Of Vesicle Localization (GO:0051650) Negative Regulation Of Cilium Assembly (GO:1902018) Negative Regulation Of Phosphorylation (GO:0042326) Negative Regulation Of Protein Autophosphorylation (GO:0031953) Negative Regulation Of Protein Serine/Threonine Kinase Activity (GO:0071901) Podocyte Cell Migration (GO:0090521) Positive Regulation Of Protein Localization To Nucleus (GO:1900182) Positive Regulation Of Protein Phosphorylation (GO:0001934) Positive Regulation Of Stress Fiber Assembly (GO:0051496) Positive Regulation Of Substrate Adhesion-Dependent Cell Spreading (GO:1900026) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Regulation Of Protein Localization (GO:0032880) Spermatogenesis (GO:0007283)
Molecular Function	ATP Binding (GO:0005524) Metal Ion Binding (GO:0046872) Protein C-Terminus Binding (GO:0008022) Protein Kinase Activity (GO:0004672) Protein Kinase Binding (GO:0019901) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) Protein Serine/Threonine/Tyrosine Kinase Activity (GO:0004712) Protein Tyrosine Kinase Activity (GO:0004713)

Cross-References

Database	Links
UNIPROT	O70146 O70147 Q499W7
Pfam	PF07714
PROSITE	PS00107 PS50011 PS00109

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK