Ubiquitin carboxyl-terminal hydrolase 2 - Homo sapiens

Ubiquitin carboxyl-terminal hydrolase 2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ubiquitin carboxyl-terminal hydrolase 2
Accession Code	O75604
Gene	USP2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 605)
MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPL LRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYR IDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETG KGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAK LIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMW RKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCR GRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTA YCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM

Structure Viewer (PDB: 5XVE)

Subcellular Location

Description
Cytoplasm {By SimilarityUniProtKB:O88623}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:O88623}. Note=Localizes in the spermatid head in late-elongating spermatids in the thin area between the outer acrosomal membrane and the plasma membrane. {By SimilarityUniProtKB:Q5U349}. [Isoform 4]: Nucleus {By SimilarityUniProtKB:Q5U349}. Membrane {By SimilarityUniProtKB:O88623}; Peripheral membrane protein {ECO:0000305}. Cytoplasm {By SimilarityUniProtKB:O88623}. Note=Predominantly expressed at membranes. {By SimilarityUniProtKB:O88623}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Curator Inference {ECO:0000305}
Assigned Ontology terms

Cellular Component	Centrosome (GO:0005813) Cytoplasm (GO:0005737) Membrane (GO:0016020) Nucleoplasm (GO:0005654) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1 (PubMed:17290220, PubMed:19917254, PubMed:19838211). Isoform 1 and isoform 4 possess both ubiquitin-specific peptidase and isopeptidase activities (By similarity). Deubiquitinates MDM2 without reversing MDM2-mediated p53/TP53 ubiquitination and thus indirectly promotes p53/TP53 degradation and limits p53 activity (PubMed:17290220, PubMed:19838211). Has no deubiquitinase activity against p53/TP53 (PubMed:17290220). Prevents MDM2-mediated degradation of MDM4 (PubMed:17290220). Plays a role in the G1/S cell-cycle progression in normal and cancer cells (PubMed:19917254). Regulates the circadian clock by modulating its intrinsic circadian rhythm and its capacity to respond to external cues (By similarity). Associates with clock proteins and deubiquitinates core clock component PER1 but does not affect its overall stability (By similarity). Regulates the nucleocytoplasmic shuttling and nuclear retention of PER1 and its repressive role on the clock transcription factors CLOCK and ARNTL/BMAL1 (By similarity). Plays a role in the regulation of myogenic differentiation of embryonic muscle cells (By similarity). {By SimilarityUniProtKB:O88623, By SimilarityUniProtKB:Q5U349, Experimental EvidencePubMed:17290220, Experimental EvidencePubMed:19838211, Experimental EvidencePubMed:19917254}. [Isoform 4]: Circadian clock output effector that regulates Ca(2+) absorption in the small intestine. Probably functions by regulating protein levels of the membrane scaffold protein NHERF4 in a rhythmic manner, and is therefore likely to control Ca(2+) membrane permeability mediated by the Ca(2+) channel TRPV6 in the intestine. {By SimilarityUniProtKB:O88623}.
Assigned Ontology terms

Biological Process	Cell Cycle (GO:0007049) Circadian Behavior (GO:0048512) Circadian Regulation Of Gene Expression (GO:0032922) Entrainment Of Circadian Clock By Photoperiod (GO:0043153) Locomotor Rhythm (GO:0045475) Muscle Organ Development (GO:0007517) Negative Regulation Of Transcription By RNA Polymerase II (GO:0000122) Positive Regulation Of Mitotic Cell Cycle (GO:0045931) Protein Deubiquitination (GO:0016579) Protein Stabilization (GO:0050821) Regulation Of Signal Transduction By P53 Class Mediator (GO:1901796) Ubiquitin-Dependent Protein Catabolic Process (GO:0006511)
Molecular Function	Cyclin Binding (GO:0030332) Cysteine-Type Deubiquitinase Activity (GO:0004843) Cysteine-Type Endopeptidase Activity (GO:0004197) Identical Protein Binding (GO:0042802) Metal Ion Binding (GO:0046872) Ubiquitin Protein Ligase Binding (GO:0031625)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q8TD16	Protein bicaudal D homolog 2	EBI-25254904	0.56
Q13137	Calcium-binding and coiled-coil domain-containing protein 2	EBI-24334992	0.56
O75140	GATOR complex protein DEPDC5	EBI-24681385	0.56
Q03252	Lamin-B2	EBI-24339221	0.56
Q96CV9	Optineurin	EBI-24491151	0.56
Q9NRD5	PRKCA-binding protein	EBI-24275762	0.56
Interactions with other proteins (131 interactors)

Partner (UniProt)		IntAct	Confidence score
P19012	Keratin, type I cytoskeletal 15 (Cytokeratin-15) (CK-15) (Keratin-15) (K15)	EBI-761008	0.70
Q96ED9	Protein Hook homolog 2 (h-hook2) (hHK2)	EBI-24357988	0.56
Q7L4P6	BEN domain-containing protein 5	EBI-754156	0.37
Q15834	Coiled-coil domain-containing protein 85B (Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A)	EBI-755458	0.37
Q12933	TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3)	EBI-757021	0.78
Q9BUH8	Brain-enriched guanylate kinase-associated protein	EBI-759049	0.37
Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	EBI-7260289	0.40
P0CG48	Polyubiquitin-C [Cleaved into: Ubiquitin]	EBI-6965847	0.44
P36776	Lon protease homolog, mitochondrial (EC 3.4.21.53) (LONHs) (Lon protease-like protein) (LONP) (Mitochondrial ATP-dependent protease Lon) (Serine protease 15)	EBI-2512362	0.40
Q9Y3B9	RRP15-like protein (Ribosomal RNA-processing protein 15)	EBI-2512362	0.40
Q92569	Phosphatidylinositol 3-kinase regulatory subunit gamma (PI3-kinase regulatory subunit gamma) (PI3K regulatory subunit gamma) (PtdIns-3-kinase regulatory subunit gamma) (Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma) (PI3-kinase subunit p55-gamma) (PtdIns-3-kinase regulatory subunit p55-gamma) (p55PIK)	EBI-10696117	0.49
Q62925	Mitogen-activated protein kinase kinase kinase 1 (EC 2.7.11.25) (MAPK/ERK kinase kinase 1) (MEK kinase 1) (MEKK 1)	EBI-9691474	0.44
Q8IYU2	E3 ubiquitin-protein ligase HACE1 (EC 2.3.2.26) (HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1) (HECT-type E3 ubiquitin transferase HACE1)	EBI-9683105	0.44
Q9NSC5	Homer protein homolog 3 (Homer-3)	EBI-10188691	0.72
I6L9F6	NEFL protein	EBI-10188701	0.56
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-10188711	0.72
Q08379	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	EBI-10188733	0.72
Q2TAC2	Coiled-coil domain-containing protein 57	EBI-10188755	0.56
Q5JR59	Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa)	EBI-10188765	0.56
Q6A162	Keratin, type I cytoskeletal 40 (Cytokeratin-40) (CK-40) (Keratin-40) (K40) (Type I hair keratin Ka36)	EBI-10188775	0.72
Q8IYA8	Interactor of HORMAD1 protein 1 (Cancer/testis antigen 74) (CT74) (Coiled-coil domain-containing protein 36)	EBI-10188785	0.56
Q8N1B4	Vacuolar protein sorting-associated protein 52 homolog (SAC2 suppressor of actin mutations 2-like protein)	EBI-10188795	0.72
Q8ND90	Paraneoplastic antigen Ma1 (37 kDa neuronal protein) (Neuron- and testis-specific protein 1)	EBI-10188805	0.56
Q969G2	LIM/homeobox protein Lhx4 (LIM homeobox protein 4)	EBI-10188815	0.67
Q96JN2	Coiled-coil domain-containing protein 136 (Nasopharyngeal carcinoma-associated gene 6 protein)	EBI-10188825	0.56
Q9BRK4	Leucine zipper putative tumor suppressor 2 (hLZTS2) (Protein LAPSER1)	EBI-10188837	0.72
Q9BVG8	Kinesin-like protein KIFC3	EBI-10188847	0.56
Q9GZM8	Nuclear distribution protein nudE-like 1 (Protein Nudel) (Mitosin-associated protein 1)	EBI-10188857	0.72
Q9UJC3	Protein Hook homolog 1 (h-hook1) (hHK1)	EBI-10188867	0.56
Q9Y4K3	TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)	EBI-10188877	0.56
P06428	Protein E6	EBI-11737925	0.37
Q9UBR4	LIM/homeobox protein Lhx3 (LIM homeobox protein 3)	EBI-24280767	0.56
Q96MT8	Centrosomal protein of 63 kDa (Cep63)	EBI-24282871	0.56
Q8WWB3	DPY30 domain-containing protein 1	EBI-24287760	0.56
O60504	Vinexin (SH3-containing adapter molecule 1) (SCAM-1) (Sorbin and SH3 domain-containing protein 3)	EBI-24296555	0.56
O96006	E3 SUMO-protein ligase ZBED1 (EC 2.3.2.-) (DNA replication-related element-binding factor) (Putative Ac-like transposable element) (Zinc finger BED domain-containing protein 1) (dREF homolog)	EBI-24296826	0.56
Q9UGI0	Ubiquitin thioesterase ZRANB1 (EC 3.4.19.12) (TRAF-binding domain-containing protein) (hTrabid) (Zinc finger Ran-binding domain-containing protein 1)	EBI-24310495	0.56
A6NLX3	Speedy protein E4	EBI-24316142	0.56
Q59EK9	RUN domain-containing protein 3A (Rap2-interacting protein 8) (RPIP-8)	EBI-24324288	0.56
Q86VP1	Tax1-binding protein 1 (TRAF6-binding protein)	EBI-24329367	0.56
Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	EBI-24334778	0.56
Q8HWS3	DNA-binding protein RFX6 (Regulatory factor X 6) (Regulatory factor X domain-containing protein 1)	EBI-24334946	0.56
Q08043	Alpha-actinin-3 (Alpha-actinin skeletal muscle isoform 3) (F-actin cross-linking protein)	EBI-24343793	0.56
Q13077	TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6)	EBI-24344810	0.56
Q86U10	60 kDa lysophospholipase (LysoLP) (EC 3.1.1.5) (Lysophospholipase-transacylase) [Includes: L-asparaginase (EC 3.5.1.1) (L-asparagine amidohydrolase); 1-alkyl-2-acetylglycerophosphocholine esterase (EC 3.1.1.47) (Platelet-activating factor acetylhydrolase) (PAF acetylhydrolase)]	EBI-24349210	0.56
Q9UKT9	Zinc finger protein Aiolos (Ikaros family zinc finger protein 3)	EBI-24353109	0.56
Q9UBB9	Tuftelin-interacting protein 11 (Septin and tuftelin-interacting protein 1) (STIP-1)	EBI-24362657	0.56
Q4G0R1	PIBF1 protein	EBI-25249913	0.56
P12814	Alpha-actinin-1 (Alpha-actinin cytoskeletal isoform) (F-actin cross-linking protein) (Non-muscle alpha-actinin-1)	EBI-25252754	0.56
Q8N6Y0	Harmonin-binding protein USHBP1 (AIE-75-binding protein) (Mutated in colon cancer protein 2) (MCC-2) (Usher syndrome type-1C protein-binding protein 1) (USH1C-binding protein 1)	EBI-25256814	0.56
Q08117	TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator)	EBI-25258322	0.56
Q9UJV3	Probable E3 ubiquitin-protein ligase MID2 (EC 2.3.2.27) (Midin-2) (Midline defect 2) (Midline-2) (RING finger protein 60) (RING-type E3 ubiquitin transferase MID2) (Tripartite motif-containing protein 1)	EBI-24488835	0.56
Q15276	Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17)	EBI-24491540	0.56
Q5JST6	EF-hand domain-containing family member C2	EBI-24500930	0.56
O00471	Exocyst complex component 5 (Exocyst complex component Sec10) (hSec10)	EBI-24504009	0.56
Q9NZV7	Zinc finger imprinted 2 (Zinc finger protein 656)	EBI-24606277	0.56
Q9NRA8	Eukaryotic translation initiation factor 4E transporter (4E-T) (eIF4E transporter) (Eukaryotic translation initiation factor 4E nuclear import factor 1)	EBI-24606648	0.56
Q6PI77	Protein BHLHb9 (bHLHb9) (Transcription regulator of 60 kDa) (p60TRP)	EBI-24616394	0.56
Q9BSW2	EF-hand calcium-binding domain-containing protein 4B (Calcium release-activated calcium channel regulator 2A) (CRAC channel regulator 2A) (Calcium release-activated channel regulator 2A) (Ras-related protein Rab-46)	EBI-24627764	0.56
P51692	Signal transducer and activator of transcription 5B	EBI-24661369	0.56
A6NEM1	Golgin subfamily A member 6-like protein 9	EBI-24676390	0.56
Q13084	39S ribosomal protein L28, mitochondrial (L28mt) (MRP-L28) (Melanoma antigen p15) (Melanoma-associated antigen recognized by T-lymphocytes) (Mitochondrial large ribosomal subunit protein bL28m)	EBI-24707853	0.56
Q9H596	Dual specificity protein phosphatase 21 (EC 3.1.3.16) (EC 3.1.3.48) (Low molecular weight dual specificity phosphatase 21) (LMW-DSP21)	EBI-24722163	0.56
Q03169	Tumor necrosis factor alpha-induced protein 2 (TNF alpha-induced protein 2) (Primary response gene B94 protein)	EBI-24732317	0.56
Q6MZQ0	Proline-rich protein 5-like (Protein observed with Rictor-2) (Protor-2)	EBI-24740293	0.56
Q9UK41	Vacuolar protein sorting-associated protein 28 homolog (H-Vps28) (ESCRT-I complex subunit VPS28)	EBI-24740082	0.56
Q8N9I9	Probable E3 ubiquitin-protein ligase DTX3 (EC 2.3.2.27) (Protein deltex-3) (Deltex3) (RING finger protein 154) (RING-type E3 ubiquitin transferase DTX3)	EBI-24750467	0.56
Q5VZ52	MORN repeat-containing protein 5	EBI-25280987	0.56
P36406	E3 ubiquitin-protein ligase TRIM23 (EC 2.3.2.27) (ADP-ribosylation factor domain-containing protein 1) (GTP-binding protein ARD-1) (RING finger protein 46) (RING-type E3 ubiquitin transferase TRIM23) (Tripartite motif-containing protein 23)	EBI-24374020	0.56
Q8WW24	Tektin-4	EBI-24376880	0.56
P57678	Gem-associated protein 4 (Gemin-4) (Component of gems 4) (p97)	EBI-24379179	0.56
P35609	Alpha-actinin-2 (Alpha-actinin skeletal muscle isoform 2) (F-actin cross-linking protein)	EBI-24380145	0.56
P07196	Neurofilament light polypeptide (NF-L) (68 kDa neurofilament protein) (Neurofilament triplet L protein)	EBI-24382979	0.56
Q96CA5	Baculoviral IAP repeat-containing protein 7 (EC 2.3.2.27) (Kidney inhibitor of apoptosis protein) (KIAP) (Livin) (Melanoma inhibitor of apoptosis protein) (ML-IAP) (RING finger protein 50) (RING-type E3 ubiquitin transferase BIRC7) [Cleaved into: Baculoviral IAP repeat-containing protein 7 30kDa subunit (Truncated livin) (p30-Livin) (tLivin)]	EBI-24387672	0.56
Q15323	Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31)	EBI-24391617	0.56
Q92764	Keratin, type I cuticular Ha5 (Hair keratin, type I Ha5) (Keratin-35) (K35)	EBI-24396907	0.56
Q9H257	Caspase recruitment domain-containing protein 9 (hCARD9)	EBI-24398017	0.56
A2RRN7	CADPS protein	EBI-24404520	0.56
Q4V328	GRIP1-associated protein 1 (GRASP-1) [Cleaved into: GRASP-1 C-terminal chain (30kDa C-terminus form)]	EBI-24407518	0.56
O76011	Keratin, type I cuticular Ha4 (Hair keratin, type I Ha4) (Keratin-34) (K34)	EBI-25262386	0.56
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-24423575	0.56
Q86XT4	E3 ubiquitin-protein ligase TRIM50 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase TRIM50) (Tripartite motif-containing protein 50)	EBI-24429111	0.56
Q9NYA3	Golgin subfamily A member 6A (Golgin linked to PML) (Golgin-like protein)	EBI-24435378	0.56
Q58EX7	Puratrophin-1 (Pleckstrin homology domain-containing family G member 4) (PH domain-containing family G member 4) (Purkinje cell atrophy-associated protein 1)	EBI-24435792	0.56
Q70EL1	Inactive ubiquitin carboxyl-terminal hydrolase 54 (Inactive ubiquitin-specific peptidase 54)	EBI-24438478	0.56
Q7Z3Y8	Keratin, type I cytoskeletal 27 (Cytokeratin-27) (CK-27) (Keratin-25C) (K25C) (Keratin-27) (K27) (Type I inner root sheath-specific keratin-K25irs3)	EBI-24439251	0.56
Q15742	NGFI-A-binding protein 2 (EGR-1-binding protein 2) (Melanoma-associated delayed early response protein) (Protein MADER)	EBI-24440205	0.56
Q96B26	Exosome complex component RRP43 (Exosome component 8) (Opa-interacting protein 2) (OIP-2) (Ribosomal RNA-processing protein 43) (p9)	EBI-24444152	0.56
P56945	Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)	EBI-24457734	0.56
A6NC98	Coiled-coil domain-containing protein 88B (Brain leucine zipper domain-containing protein) (Gipie) (Hook-related protein 3) (HkRP3)	EBI-24460031	0.56
Q8WTU0	Protein DDI1 homolog 1 (EC 3.4.23.-)	EBI-24465472	0.56
Q8N4Y2	EF-hand calcium-binding domain-containing protein 4A (Calcium release-activated calcium channel regulator 2B) (CRAC channel regulator 2B) (Calcium release-activated channel regulator 2B)	EBI-24466676	0.56
O14492	SH2B adapter protein 2 (Adapter protein with pleckstrin homology and Src homology 2 domains) (SH2 and PH domain-containing adapter protein APS)	EBI-24471842	0.56
Q8NHQ1	Centrosomal protein of 70 kDa (Cep70) (p10-binding protein)	EBI-24472380	0.56
Q15654	Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1)	EBI-24473595	0.56
Q86V38	Atrophin 1	EBI-24474468	0.56
P60903	Protein S100-A10 (Calpactin I light chain) (Calpactin-1 light chain) (Cellular ligand of annexin II) (S100 calcium-binding protein A10) (p10 protein) (p11)	EBI-24539216	0.56
Q14525	Keratin, type I cuticular Ha3-II (Hair keratin, type I Ha3-II) (Keratin-33B) (K33B)	EBI-24542306	0.56
Q16633	POU domain class 2-associating factor 1 (B-cell-specific coactivator OBF-1) (BOB-1) (OCA-B) (OCT-binding factor 1)	EBI-24545862	0.56
Q9GZV8	PR domain zinc finger protein 14 (EC 2.1.1.-) (PR domain-containing protein 14)	EBI-24548496	0.56
O75564	Jerky protein homolog	EBI-24569259	0.56
Q14451	Growth factor receptor-bound protein 7 (B47) (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein)	EBI-24585126	0.56
Q96N16	Janus kinase and microtubule-interacting protein 1 (GABA-B receptor-binding protein) (Multiple alpha-helices and RNA-linker protein 1) (Marlin-1)	EBI-24585374	0.56
Q5TA45	Integrator complex subunit 11 (Int11) (EC 3.1.27.-) (Cleavage and polyadenylation-specific factor 3-like protein) (CPSF3-like protein) (Protein related to CPSF subunits of 68 kDa) (RC-68)	EBI-24591175	0.56
Q674X7	Kazrin	EBI-24593291	0.56
O43482	Protein Mis18-beta (Cancer/testis antigen 86) (CT86) (Opa-interacting protein 5) (OIP-5)	EBI-24597090	0.56
Q99932	Sperm-associated antigen 8 (HSD-1) (Sperm membrane protein 1) (SMP-1) (Sperm membrane protein BS-84)	EBI-24635245	0.56
Q5U5U6	Epididymis secretory protein Li 50 (Ubiquitin B) (Ubiquitin B, isoform CRA_a)	EBI-15596142	0.44
P62990	Ubiquitin-60S ribosomal protein L40 (Ubiquitin A-52 residue ribosomal protein fusion product 1) [Cleaved into: Ubiquitin; 60S ribosomal protein L40 (CEP52)]	EBI-15596163	0.44
G5E9A7	Dystrophia myotonica WD repeat-containing protein (Dystrophia myotonica-containing WD repeat motif, isoform CRA_a)	EBI-25842356	0.56
Q01658	Protein Dr1 (Down-regulator of transcription 1) (Negative cofactor 2-beta) (NC2-beta) (TATA-binding protein-associated phosphoprotein)	EBI-25845689	0.56
Q00403	Transcription initiation factor IIB (EC 2.3.1.48) (General transcription factor TFIIB) (S300-II)	EBI-25865141	0.56
P04792	Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress-responsive protein 27) (SRP27)	EBI-25870731	0.56
O60260	E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2)	EBI-25879990	0.56
D3DTS7	Peripheral myelin protein 22, isoform CRA_a	EBI-25882988	0.56
P60891	Ribose-phosphate pyrophosphokinase 1 (EC 2.7.6.1) (PPRibP) (Phosphoribosyl pyrophosphate synthase I) (PRS-I)	EBI-25886321	0.56
O76024	Wolframin	EBI-25897757	0.56
Q9Y5Q9	General transcription factor 3C polypeptide 3 (Transcription factor IIIC 102 kDa subunit) (TFIIIC 102 kDa subunit) (TFIIIC102) (Transcription factor IIIC subunit gamma) (TF3C-gamma)	EBI-25907028	0.56
Q7Z333	Probable helicase senataxin (EC 3.6.4.-) (Amyotrophic lateral sclerosis 4 protein) (SEN1 homolog) (Senataxin)	EBI-25914242	0.56
O60333	Kinesin-like protein KIF1B (Klp)	EBI-25915065	0.56
Q9Y3C5	RING finger protein 11	EBI-25918668	0.56
O43464	Serine protease HTRA2, mitochondrial (EC 3.4.21.108) (High temperature requirement protein A2) (HtrA2) (Omi stress-regulated endoprotease) (Serine protease 25) (Serine proteinase OMI)	EBI-25920135	0.56
Q8WXH2	Junctophilin-3 (JP-3) (Junctophilin type 3) (Trinucleotide repeat-containing gene 22 protein)	EBI-25927547	0.56
Q7Z699	Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1)	EBI-25931364	0.56
P00441	Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1)	EBI-25934473	0.56
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-25936228	0.56
P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	EBI-25940368	0.56
P42858	Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment]	EBI-25943183	0.56
P54253	Ataxin-1 (Spinocerebellar ataxia type 1 protein)	EBI-25975184	0.56
Q13148	TAR DNA-binding protein 43 (TDP-43)	EBI-25983520	0.56
Q13616	Cullin-1 (CUL-1)	EBI-26585225	0.44

Cross-References

Database	Links
UNIPROT	O75604 B0YJB8 E9PPM2 Q8IUM2 Q8IW04 Q96MB9 Q9BQ21
PDB	2HD5 2IBI 3NHE 3V6C 3V6E 5XU8 5XVE 6DGF
Pfam	PF00443
PROSITE	PS00972 PS00973 PS50235
OMIM	604725
DisGeNET	9099

Ubiquitin carboxyl-terminal hydrolase 2 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 5XVE)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (6 interactors)

Interactions with other proteins (131 interactors)

Cross-References

Database

Links

Description

Description