High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A - Homo sapiens

High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
Accession Code	O76083
Gene	PDE9A
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 593)
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRP VAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQV AEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCV AQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNI FSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM KELQKKTDSLTSGATEKSRERSRDVKNSEGDCA

Structure Viewer (PDB: 3K3H)

Subcellular Location

Description
[Isoform PDE9A1]: Cell projection, ruffle membrane {Experimental EvidencePubMed:17090334}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:17090334}. Golgi apparatus {Experimental EvidencePubMed:17090334}. Endoplasmic reticulum {Experimental EvidencePubMed:17090334}. Cell membrane, sarcolemma {ECO:0000269\|PubMed:25799991}. [Isoform PDE9A2]: Cell projection, ruffle membrane {Experimental EvidencePubMed:17090334}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:17090334}. [Isoform PDE9A3]: Cytoplasm {Experimental EvidencePubMed:17090334}. Endoplasmic reticulum {Experimental EvidencePubMed:17090334}. [Isoform PDE9A17]: Cytoplasm {Experimental EvidencePubMed:17090334}. Endoplasmic reticulum {Experimental EvidencePubMed:17090334}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Golgi Apparatus (GO:0005794) Nucleoplasm (GO:0005654) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Ruffle Membrane (GO:0032587) Sarcolemma (GO:0042383)

Biology & Function

Description
Specifically hydrolyzes the second messenger cGMP, which is a key regulator of many important physiological processes. Highly specific: compared to other members of the cyclic nucleotide phosphodiesterase family, has the highest affinity and selectivity for cGMP (PubMed:9624146, PubMed:18757755, PubMed:21483814). Specifically regulates natriuretic-peptide-dependent cGMP signaling in heart, acting as a regulator of cardiac hypertrophy in myocytes and muscle. Does not regulate nitric oxide-dependent cGMP in heart (PubMed:25799991). Additional experiments are required to confirm whether its ability to hydrolyze natriuretic-peptide-dependent cGMP is specific to heart or is a general feature of the protein (Probable). In brain, involved in cognitive function, such as learning and long-term memory (By similarity). {By SimilarityUniProtKB:Q8QZV1, Experimental EvidencePubMed:18757755, Experimental EvidencePubMed:21483814, Experimental EvidencePubMed:25799991, Experimental EvidencePubMed:9624146, Curator Inference}.
Assigned Ontology terms

Biological Process	CGMP Catabolic Process (GO:0046069) CGMP Metabolic Process (GO:0046068) CGMP-Mediated Signaling (GO:0019934) Positive Regulation Of Cardiac Muscle Hypertrophy (GO:0010613) Signal Transduction (GO:0007165)
Molecular Function	3',5'-Cyclic-GMP Phosphodiesterase Activity (GO:0047555) 3',5'-Cyclic-Nucleotide Phosphodiesterase Activity (GO:0004114) Identical Protein Binding (GO:0042802) Metal Ion Binding (GO:0046872)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O76083	Self	EBI-16433405	0.56
Interactions with other proteins (48 interactors)

Partner (UniProt)		IntAct	Confidence score
Q13049	E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A)	EBI-753319	0.88
Q96FC7	Phytanoyl-CoA hydroxylase-interacting protein-like	EBI-10285664	0.56
Q8NAJ2	Putative uncharacterized protein encoded by LINC02913	EBI-10173127	0.56
P60410	Keratin-associated protein 10-8 (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8)	EBI-10190681	0.56
Q7Z3S9	Notch homolog 2 N-terminal-like protein A (Notch homolog 2 N-terminal-like protein)	EBI-10190711	0.67
Q9BYQ4	Keratin-associated protein 9-2 (Keratin-associated protein 9.2) (Ultrahigh sulfur keratin-associated protein 9.2)	EBI-10190721	0.56
Q9BYR5	Keratin-associated protein 4-2 (Keratin-associated protein 4.2) (Ultrahigh sulfur keratin-associated protein 4.2)	EBI-10190731	0.56
O95817	BAG family molecular chaperone regulator 3 (BAG-3) (Bcl-2-associated athanogene 3) (Bcl-2-binding protein Bis) (Docking protein CAIR-1)	EBI-10192173	0.56
P25791	Rhombotin-2 (Cysteine-rich protein TTG-2) (LIM domain only protein 2) (LMO-2) (T-cell translocation protein 2)	EBI-10202658	0.56
P49759	Dual specificity protein kinase CLK1 (EC 2.7.12.1) (CDC-like kinase 1)	EBI-10211130	0.56
P49888	Sulfotransferase 1E1 (ST1E1) (EC 2.8.2.4) (EST-1) (Estrogen sulfotransferase) (Sulfotransferase, estrogen-preferring)	EBI-10211543	0.56
Q14657	EKC/KEOPS complex subunit LAGE3 (L antigen family member 3) (Protein ESO-3) (Protein ITBA2)	EBI-10233665	0.56
Q49AN0	Cryptochrome-2	EBI-10241753	0.56
Q9BRA0	N-alpha-acetyltransferase 38, NatC auxiliary subunit (LSM domain-containing protein 1) (Phosphonoformate immuno-associated protein 2)	EBI-10296698	0.56
Q9BRU9	rRNA-processing protein UTP23 homolog	EBI-10297143	0.56
Q9H8Y8	Golgi reassembly-stacking protein 2 (GRS2) (Golgi phosphoprotein 6) (GOLPH6) (Golgi reassembly-stacking protein of 55 kDa) (GRASP55) (p59)	EBI-10309418	0.67
Q9Y260	ABP/ZF (DNA-binding protein ABP/ZF) (TRPV6 protein) (Transient receptor potential cation channel, subfamily V, member 6, isoform CRA_a)	EBI-10325620	0.56
P25377	NADP-dependent alcohol dehydrogenase 7 (EC 1.1.1.2) (NADP-dependent alcohol dehydrogenase VII) (ADHVII)	EBI-11524546	0.56
P32502	Translation initiation factor eIF-2B subunit beta (GCD complex subunit GCD7) (Guanine nucleotide exchange factor subunit GCD7) (eIF-2B GDP-GTP exchange factor subunit beta)	EBI-11525726	0.56
P38744	Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD)	EBI-11529381	0.56
P39518	Long-chain-fatty-acid--CoA ligase 2 (EC 6.2.1.3) (Fatty acid activator 2) (Long-chain acyl-CoA synthetase 2)	EBI-11529837	0.56
P40454	Serine/threonine-protein phosphatase 2A activator 1 (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-1) (PPIase PTPA-1) (Rotamase PTPA-1) (Phosphotyrosyl phosphatase activator 1)	EBI-11530904	0.56
Q00618	Geranylgeranyl transferase type-2 subunit alpha (EC 2.5.1.60) (GGTase-II-alpha) (Geranylgeranyl transferase type II subunit alpha) (PGGT) (Type II protein geranyl-geranyltransferase subunit alpha) (YPT1/SEC4 proteins geranylgeranyltransferase subunit alpha)	EBI-11534143	0.56
Q12259	BTB/POZ domain-containing protein YLR108C	EBI-11536954	0.56
O00560	Syntenin-1 (Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1)	EBI-24276653	0.56
P61964	WD repeat-containing protein 5 (BMP2-induced 3-kb gene protein)	EBI-24286856	0.56
O15205	Ubiquitin D (Diubiquitin) (Ubiquitin-like protein FAT10)	EBI-24291537	0.56
P26371	Keratin-associated protein 5-9 (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (Keratin-associated protein 5.9) (UHS keratin A) (UHS KerA) (Ultrahigh sulfur keratin-associated protein 5.9)	EBI-24298959	0.56
Q99633	Pre-mRNA-splicing factor 18 (PRP18 homolog) (hPRP18)	EBI-24316761	0.56
Q16649	Nuclear factor interleukin-3-regulated protein (E4 promoter-binding protein 4) (Interleukin-3 promoter transcriptional activator) (Interleukin-3-binding protein 1) (Transcriptional activator NF-IL3A)	EBI-24491918	0.56
Q15051	IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ)	EBI-24524430	0.56
P59991	Keratin-associated protein 12-2 (High sulfur keratin-associated protein 12.2) (Keratin-associated protein 12.2)	EBI-24372163	0.56
A8MQ03	Cysteine-rich tail protein 1	EBI-24378365	0.56
P60411	Keratin-associated protein 10-9 (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9)	EBI-24407802	0.56
Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein)	EBI-24409161	0.56
P60328	Keratin-associated protein 12-3 (High sulfur keratin-associated protein 12.3) (Keratin-associated protein 12.3)	EBI-25262737	0.56
Q07627	Keratin-associated protein 1-1 (High sulfur keratin-associated protein 1.1) (Keratin-associated protein 1.1) (Keratin-associated protein 1.6) (Keratin-associated protein 1.7)	EBI-24418030	0.56
Q8IUG1	Keratin-associated protein 1-3 (Keratin-associated protein 1.8) (Keratin-associated protein 1.9)	EBI-24436343	0.56
O76011	Keratin, type I cuticular Ha4 (Hair keratin, type I Ha4) (Keratin-34) (K34)	EBI-24437958	0.56
Q16543	Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed]	EBI-24460241	0.56
P60409	Keratin-associated protein 10-7 (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7)	EBI-24468187	0.56
Q96DX4	RING finger and SPRY domain-containing protein 1	EBI-11903808	0.00
Q8TAD7	Overexpressed in colon carcinoma 1 protein (OCC-1) (AGD3)	EBI-11903800	0.00
Q7Z494	Nephrocystin-3	EBI-11903789	0.00
Q13237	cGMP-dependent protein kinase 2 (cGK 2) (cGK2) (EC 2.7.11.12) (cGMP-dependent protein kinase II) (cGKII)	EBI-11903780	0.00
Q13432	Protein unc-119 homolog A (Retinal protein 4) (hRG4)	EBI-21558921	0.35
P51114	RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p)	EBI-26510978	0.37
P51116	RNA-binding protein FXR2 (FMR1 autosomal homolog 2)	EBI-26512056	0.37

Cross-References

Database	Links
UNIPROT	O76083 B2RBI5 B4DFI5 D3DSJ8 D3DSJ9 O75490 O75491 O95225 Q53Y40 Q5QD39 Q86SF7 Q86SI6 Q86SJ3 Q86WN3 Q86WN4 Q86WN5 Q86WN6 Q86WN7 Q86WN8 Q86WN9 Q86WP0
PDB	2HD1 2YY2 3DY8 3DYL 3DYN 3DYQ 3DYS 3JSI 3JSW 3K3E 3K3H 3N3Z 3QI3 3QI4 4E90 4G2J 4G2L 4GH6 4Y86 4Y87 4Y8C 6A3N 6LZZ 7F0I
Pfam	PF00233
PROSITE	PS00126 PS51845
OMIM	602973
DisGeNET	5152

High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 3K3H)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (48 interactors)

Cross-References

Database

Links

Description

Description