NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Ensconsin - Mus musculus - NucEnvDB

Ensconsin (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ensconsin
Accession Code	O88735
Gene	Map7
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 730)
MAEQGAGGDGHRGGDGATHSDPASDGYKVQEKRTAPSRPTSTVSGQTSNHSGNKPDPPPVLRVDDRQRLARERREEREKQLAARETVWLEREERARQHYERHLEARKKKLEDQRLKEERRRAAVEEKRRQ RLEEDKERHEAVVRRTMERSQKPRQKSNRWSWGSPLHGSSSIHSGDPDRRSVSTMNLSKHVDPVISKRLSSSSATLLNSPDRARRLQLSPWESSVVSRLLTPTHSFLARSKSTAALSGDTASCSPIIMPF KAAHSRNPVDRPKLFVTPPEGSARRRTIHGLASHKREREREHVPFHVSPGARRTLSPSNLKARSPAPARLWLPSKSMPHLPGTPRPASSLPPGSVRAASAQAPSSSPGNIRPFKREVKVEPEKKDPLPAV KSRVPLVKVEEVTVEEGTPVKPPEPAAPASAPIATPAPAPATDPAPVPAPSSTVTVGVVPKTSAGTTDPEEATRLLAEKRRLAREQREKEERERKEKEELERQKIEELARRVAEERSRREEEARRLEEEQ AREKEELALRLAEEERERWEREEVERVQKQKEEEARAREEAERARQEREKHFQKEEQERLERKKRLEEIMRRTRRTETADKKTTEQRNGDIAKGVLTGEPEVPALPCMASSGNGESAESPHGVALQQSEV TTESSPDLEKQPNENGMSIQNENFEEVINLPVGSKASRLDVTNENPEIPLKPILAFNDEGTLGPLPQVDGVQTQQTAEVI

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:14517216}. Basolateral cell membrane {Experimental EvidencePubMed:14517216}. Cytoplasm, cytoskeleton {Experimental EvidencePubMed:14517216}. Note=Colocalized on microtubules. An intracellular redistribution is triggered during induction of keratinocyte terminal differentiation from microtubules with a perinuclear localization to cortical microtubules organized in spike- like bundles facing intercellular contacts.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Axon (GO:0030424) Basolateral Plasma Membrane (GO:0016323) Cytosol (GO:0005829) Microtubule (GO:0005874) Microtubule Cytoskeleton (GO:0015630) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Microtubule-stabilizing protein that may play an important role during reorganization of microtubules during polarization and differentiation of epithelial cells. Associates with microtubules in a dynamic manner. May play a role in the formation of intercellular contacts. Colocalization with TRPV4 results in the redistribution of TRPV4 toward the membrane and may link cytoskeletal microfilaments. {Experimental EvidencePubMed:14517216}.
Assigned Ontology terms

Biological Process	Cell Morphogenesis (GO:0000902) Cell Population Proliferation (GO:0008283) Fertilization (GO:0009566) Germ Cell Development (GO:0007281) Glycosphingolipid Metabolic Process (GO:0006687) Homeostasis Of Number Of Cells (GO:0048872) Leydig Cell Differentiation (GO:0033327) Microtubule Bundle Formation (GO:0001578) Microtubule Cytoskeleton Organization (GO:0000226) Nucleus Organization (GO:0006997) Organ Growth (GO:0035265) Protein Localization To Plasma Membrane (GO:0072659) Response To Osmotic Stress (GO:0006970) Response To Retinoic Acid (GO:0032526) Sertoli Cell Development (GO:0060009) Spermatogenesis (GO:0007283)
Molecular Function	Signaling Receptor Binding (GO:0005102)

Protein-Protein Interactions

Interactions with other proteins (1 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9QWI6	SRC kinase signaling inhibitor 1 (SNAP-25-interacting protein) (SNIP) (p130Cas-associated protein) (p140Cap)	EBI-27100778	0.35

Cross-References

Database	Links
UNIPROT	O88735 Q3V0B9 Q7TQL9 Q80V60
Pfam	PF05672

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK