Protein Information |
|
|---|---|
| Protein Name | Apoptosis-inducing factor 1, mitochondrial |
| Accession Code | O95831 |
| Gene | AIFM1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 613) | |
|
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGA GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVL IVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALG RKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGL EPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDY GKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED |
|
Structure Viewer (PDB: 4FDC) |
|---|
Description |
||
|---|---|---|
| Mitochondrion intermembrane space {Experimental EvidencePubMed:15775970, Experimental EvidencePubMed:24914854, Experimental EvidencePubMed:26004228}. Mitochondrion inner membrane. Cytoplasm {Experimental EvidencePubMed:15775970, Experimental EvidencePubMed:33168626}. Nucleus {Experimental EvidencePubMed:15775970, Experimental EvidencePubMed:17094969, Experimental EvidencePubMed:33168626}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:17094969}. Note=Proteolytic cleavage during or just after translocation into the mitochondrial intermembrane space (IMS) results in the formation of an inner-membrane-anchored mature form (AIFmit). During apoptosis, further proteolytic processing leads to a mature form, which is confined to the mitochondrial IMS in a soluble form (AIFsol). AIFsol is released to the cytoplasm in response to specific death signals, and translocated to the nucleus, where it induces nuclear apoptosis (PubMed:15775970). Release into the cytoplasm is mediated upon binding to poly-ADP-ribose chains (By similarity). Translocation into the nucleus is promoted by interaction with (auto- poly-ADP-ribosylated) processed form of PARP1 (PubMed:33168626). Colocalizes with EIF3G in the nucleus and perinuclear region (PubMed:17094969). {ECO:0000250|UniProtKB:Q9Z0X1, Experimental EvidencePubMed:15775970, Experimental EvidencePubMed:17094969, Experimental EvidencePubMed:33168626}. [Isoform 3]: Mitochondrion intermembrane space {ECO:0000269|PubMed:20111043}. Mitochondrion inner membrane {ECO:0000269|PubMed:20111043}. Note=Has a stronger membrane anchorage than isoform 1. {ECO:0000269|PubMed:20111043}. [Isoform 4]: Mitochondrion {ECO:0000269|PubMed:16644725}. Cytoplasm, cytosol {ECO:0000269|PubMed:16644725}. Note=In pro-apoptotic conditions, is released from mitochondria to cytosol in a calpain/cathepsin-dependent manner. {ECO:0000269|PubMed:16644725}. [Isoform 5]: Cytoplasm {ECO:0000269|PubMed:16365034}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Mitochondrial Inner Membrane (GO:0005743) Mitochondrial Intermembrane Space (GO:0005758) Mitochondrion (GO:0005739) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
| Combined oxidative phosphorylation deficiency 6 (COXPD6) [MIM:300816]: A mitochondrial disease resulting in a neurodegenerative disorder characterized by psychomotor delay, hypotonia, areflexia, muscle weakness and wasting. Some patients manifest prenatal ventriculomegaly and severe postnatal encephalomyopathy. {Experimental EvidencePubMed:20362274, Experimental EvidencePubMed:22019070, Experimental EvidencePubMed:25583628, Experimental EvidencePubMed:26004228, Experimental EvidencePubMed:26173962, Experimental EvidencePubMed:27178839}. Note=The disease is caused by variants affecting the gene represented in this entry. Charcot-Marie-Tooth disease, X-linked recessive, 4, with or without cerebellar ataxia (CMTX4) [MIM:310490]: A neuromuscular disorder characterized by progressive sensorimotor axonal neuropathy, distal sensory impairment, difficulty walking due to peripheral neuropathy and/or cerebellar ataxia, and deafness due to auditory neuropathy. Additional features include cognitive impairment, cerebellar atrophy, dysarthria, abnormal extraocular movements, tremor, dysmetria and spasticity. The age at onset ranges from infancy to young adulthood. {Experimental EvidencePubMed:23217327, Experimental EvidencePubMed:26004228}. Note=The disease is caused by variants affecting the gene represented in this entry. Deafness, X-linked, 5, with peripheral neuropathy (DFNX5) [MIM:300614]: A form of hearing loss characterized by absent or severely abnormal auditory brainstem response, abnormal middle ear reflexes, abnormal speech discrimination, loss of outer hair cell function, and cochlear nerve hypoplasia. DFNX5 patients manifest auditory neuropathy with childhood onset, associated with distal sensory impairment affecting the peripheral nervous system. {Experimental EvidencePubMed:25986071}. Note=The disease is caused by variants affecting the gene represented in this entry. Spondyloepimetaphyseal dysplasia, X-linked, with hypomyelinating leukodystrophy (SEMDHL) [MIM:300232]: An X-linked recessive developmental disorder characterized by slowly progressive skeletal and neurologic abnormalities, including short stature, large and deformed joints, significant motor impairment, visual defects, and sometimes cognitive deficits. Affected individuals typically have normal early development in the first year or so of life, followed by development regression and the development of symptoms. Brain imaging shows white matter abnormalities consistent with hypomyelinating leukodystrophy. {ECO:0000269|PubMed:28842795}. Note=The disease is caused by variants affecting the gene represented in this entry. | Database Associations |
| OMIM | 300169 300232 300614 300816 310490 |
| DisGeNET | 9131 |
Interactions with Nuclear Envelope proteins (11 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A0A142I5B9 | RNA-directed RNA polymerase NS5 | EBI-20625330 | 0.35 |
| O00165 | HCLS1-associated protein X-1 | EBI-16786283 | 0.42 |
| O15027 | Protein transport protein Sec16A | EBI-16786589 | 0.42 |
| O75821 | Eukaryotic translation initiation factor 3 subunit G | EBI-7083391 | 0.60 |
| Q8IX03 | Protein KIBRA | EBI-737309 | 0.00 |
| O95831 | Self | EBI-5651205 | 0.40 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| Q5JTV8 | Torsin-1A-interacting protein 1 | EBI-11159793 | 0.53 |
| P31689 | DnaJ homolog subfamily A member 1 | EBI-16786283 | 0.27 |
| P05129 | Protein kinase C gamma type | EBI-25379555 | 0.35 |
| P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-25509687 | 0.35 | Interactions with other proteins (297 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P08107 | Heat shock 70 kDa protein 1A (Heat shock 70 kDa protein 1) (HSP70-1) (HSP70.1) | EBI-7947560 | 0.54 |
| Q13233 | Mitogen-activated protein kinase kinase kinase 1 (EC 2.7.11.25) (MAPK/ERK kinase kinase 1) (MEK kinase 1) (MEKK 1) | EBI-361788 | 0.00 |
| Q99759 | Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) | EBI-362055 | 0.00 |
| Q00653 | Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor KBF2) (H2TF1) (Lymphocyte translocation chromosome 10 protein) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2) (Oncogene Lyt-10) (Lyt10) [Cleaved into: Nuclear factor NF-kappa-B p52 subunit] | EBI-362688 | 0.00 |
| Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | EBI-363205 | 0.00 |
| Q9Y572 | Receptor-interacting serine/threonine-protein kinase 3 (EC 2.7.11.1) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3) | EBI-363715 | 0.00 |
| P20333 | Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2 (TBP-2) (TBPII)] | EBI-364540 | 0.00 |
| Q15628 | Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain) | EBI-364813 | 0.00 |
| Q9NX70 | Mediator of RNA polymerase II transcription subunit 29 (Intersex-like protein) (Mediator complex subunit 29) | EBI-394875 | 0.35 |
| Q15047 | Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1) | EBI-732770 | 0.00 |
| O76061 | Stanniocalcin-2 (STC-2) (Stanniocalcin-related protein) (STC-related protein) (STCRP) | EBI-732773 | 0.00 |
| Q8NC60 | Nitric oxide-associated protein 1 | EBI-737306 | 0.00 |
| Q9Y3Q8 | TSC22 domain family protein 4 (TSC22-related-inducible leucine zipper protein 2) (Tsc-22-like protein THG-1) | EBI-946353 | 0.51 |
| O75365 | Protein tyrosine phosphatase type IVA 3 (EC 3.1.3.48) (PRL-R) (Protein-tyrosine phosphatase 4a3) (Protein-tyrosine phosphatase of regenerating liver 3) (PRL-3) | EBI-1060356 | 0.00 |
| Q15773 | Myeloid leukemia factor 2 (Myelodysplasia-myeloid leukemia factor 2) | EBI-16786283 | 0.60 |
| Q9HAW0 | Transcription factor IIIB 50 kDa subunit (TFIIIB50) (hTFIIIB50) (B-related factor 2) (BRF-2) (hBRFU) | EBI-1070570 | 0.00 |
| Q9BRX2 | Protein pelota homolog (EC 3.1.-.-) | EBI-1071657 | 0.00 |
| Q92956 | Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270) | EBI-1075816 | 0.00 |
| P01889 | HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B) | EBI-1077732 | 0.00 |
| Q9BUV8 | Respirasome Complex Assembly Factor 1 (Rab5-interacting protein) (RIP5) | EBI-1083497 | 0.00 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-1170380 | 0.35 |
| P83887 | Tubulin gamma-1 chain (Gamma-1-tubulin) (Gamma-tubulin complex component 1) (GCP-1) | EBI-2561869 | 0.40 |
| P16104 | Histone H2AX (H2a/x) (Histone H2A.X) | EBI-2564373 | 0.35 |
| Q8N0X7 | Spartin (Spastic paraplegia 20 protein) (Trans-activated by hepatitis C virus core protein 1) | EBI-2643801 | 0.35 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-2878124 | 0.35 |
| P40692 | DNA mismatch repair protein Mlh1 (MutL protein homolog 1) | EBI-2932395 | 0.37 |
| Q9H492 | Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha) | EBI-3044058 | 0.35 |
| Q9GZQ8 | Microtubule-associated proteins 1A/1B light chain 3B (Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta) | EBI-3045543 | 0.35 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-3048562 | 0.35 |
| O95166 | Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46) | EBI-3050465 | 0.35 |
| Q14197 | Peptidyl-tRNA hydrolase ICT1, mitochondrial (EC 3.1.1.29) (39S ribosomal protein L58, mitochondrial) (MRP-L58) (Digestion substraction 1) (DS-1) (Immature colon carcinoma transcript 1 protein) (Mitochondrial large ribosomal subunit protein mL62) | EBI-7825470 | 0.35 |
| Q96HA7 | Tonsoku-like protein (Inhibitor of kappa B-related protein) (I-kappa-B-related protein) (IkappaBR) (NF-kappa-B inhibitor-like protein 2) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 2) | EBI-8522027 | 0.35 |
| P62937 | Peptidyl-prolyl cis-trans isomerase A (PPIase A) (EC 5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed] | EBI-4533343 | 0.46 |
| P0DOE9 | Non-structural protein 1 (NS1) (Non-structural protein 1C) | EBI-6138583 | 0.35 |
| Q8JPQ9 | Non-structural protein NS-S | EBI-6159460 | 0.35 |
| Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein) | EBI-6223407 | 0.60 |
| O95747 | Serine/threonine-protein kinase OSR1 (EC 2.7.11.1) (Oxidative stress-responsive 1 protein) | EBI-6255369 | 0.35 |
| Q13418 | Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK) | EBI-6256400 | 0.53 |
| Q77M19 | V protein | EBI-6270503 | 0.35 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q13617 | Cullin-2 (CUL-2) | EBI-21327106 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q93034 | Cullin-5 (CUL-5) (Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1) | EBI-21331078 | 0.35 |
| Q96DB2 | Histone deacetylase 11 (HD11) (EC 3.5.1.98) | EBI-6598272 | 0.35 |
| P21860 | Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3) | EBI-8770321 | 0.57 |
| Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 2) (HLA-B-associated transcript 8) (Histone H3-K9 methyltransferase 3) (H3-K9-HMTase 3) (Lysine N-methyltransferase 1C) (Protein G9a) | EBI-8832899 | 0.35 |
| Q96JM2 | Zinc finger protein 462 (Zinc finger PBX1-interacting protein) (ZFPIP) | EBI-8837110 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-9515510 | 0.53 |
| P57078 | Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase) | EBI-12503575 | 0.35 |
| O75807 | Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog) | EBI-9976880 | 0.35 |
| P10398 | Serine/threonine-protein kinase A-Raf (EC 2.7.11.1) (Proto-oncogene A-Raf) (Proto-oncogene A-Raf-1) (Proto-oncogene Pks) | EBI-10101513 | 0.35 |
| P51617 | Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1) | EBI-10103481 | 0.35 |
| Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770028 | 0.35 |
| P19838 | Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit] | EBI-11322719 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
| O43920 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (Complex I-15 kDa) (CI-15 kDa) (NADH-ubiquinone oxidoreductase 15 kDa subunit) | EBI-10762907 | 0.57 |
| P03220 | Protein BGLF3 | EBI-11722152 | 0.35 |
| P03225 | Protein BDLF2 | EBI-11722220 | 0.35 |
| P06460 | Probable protein E5A | EBI-11723082 | 0.35 |
| P0CK49 | Tegument protein UL51 homolog | EBI-11725356 | 0.35 |
| P0CK56 | Uncharacterized protein BDLF4 | EBI-11725466 | 0.35 |
| Q2MG95 | BVLF1 | EBI-11733653 | 0.35 |
| Q5T3F8 | CSC1-like protein 2 (Transmembrane protein 63B) | EBI-11155257 | 0.35 |
| Q96NL6 | Sodium channel and clathrin linker 1 (Sodium channel-associated protein 1) | EBI-11376636 | 0.27 |
| O94905 | Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2) | EBI-11425731 | 0.35 |
| Q13509 | Tubulin beta-3 chain (Tubulin beta-4 chain) (Tubulin beta-III) | EBI-11897134 | 0.35 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-11897791 | 0.35 |
| O14829 | Serine/threonine-protein phosphatase with EF-hands 1 (PPEF-1) (EC 3.1.3.16) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine-protein phosphatase 7) (PP7) | EBI-14023711 | 0.35 |
| Q05322 | Membrane-associated protein VP24 (Ebola VP24) (eVP24) | EBI-16214737 | 0.35 |
| Q400G9 | Archaemetzincin-1 (EC 3.4.-.-) (Archeobacterial metalloproteinase-like protein 1) | EBI-21768785 | 0.35 |
| O95470 | Sphingosine-1-phosphate lyase 1 (S1PL) (SP-lyase 1) (SPL 1) (hSPL) (EC 4.1.2.27) (Sphingosine-1-phosphate aldolase) | EBI-21820286 | 0.35 |
| Q05209 | Tyrosine-protein phosphatase non-receptor type 12 (EC 3.1.3.48) (PTP-PEST) (Protein-tyrosine phosphatase G1) (PTPG1) | EBI-21820311 | 0.35 |
| Q8NI37 | Protein phosphatase PTC7 homolog (EC 3.1.3.16) (T-cell activation protein phosphatase 2C) (TA-PP2C) (T-cell activation protein phosphatase 2C-like) | EBI-21820367 | 0.35 |
| Q8WY91 | Peroxynitrite isomerase THAP4 (EC 5.99.-.-) (Ferric Homo sapiens nitrobindin) (Hs-Nb(III)) (THAP domain-containing protein 4) | EBI-21820422 | 0.35 |
| Q9HAS0 | Protein Njmu-R1 | EBI-21820465 | 0.35 |
| Q6UXV4 | MICOS complex subunit MIC27 (Apolipoprotein O-like) (Protein FAM121A) | EBI-21859075 | 0.35 |
| Q9BV35 | Calcium-binding mitochondrial carrier protein SCaMC-3 (Mitochondrial ATP-Mg/Pi carrier protein 2) (Mitochondrial Ca(2+)-dependent solute carrier protein 2) (Small calcium-binding mitochondrial carrier protein 3) (Solute carrier family 25 member 23) | EBI-21859075 | 0.35 |
| Q6JQN1 | Acyl-CoA dehydrogenase family member 10 (ACAD-10) (EC 1.3.99.-) | EBI-21859075 | 0.35 |
| Q658Y4 | Protein FAM91A1 | EBI-21859075 | 0.35 |
| Q08357 | Sodium-dependent phosphate transporter 2 (Gibbon ape leukemia virus receptor 2) (GLVR-2) (Phosphate transporter 2) (PiT-2) (Pit2) (hPit2) (Solute carrier family 20 member 2) | EBI-21859075 | 0.35 |
| P55789 | FAD-linked sulfhydryl oxidase ALR (EC 1.8.3.2) (Augmenter of liver regeneration) (hERV1) (Hepatopoietin) | EBI-21859075 | 0.35 |
| P54819 | Adenylate kinase 2, mitochondrial (AK 2) (EC 2.7.4.3) (ATP-AMP transphosphorylase 2) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) [Cleaved into: Adenylate kinase 2, mitochondrial, N-terminally processed] | EBI-16786283 | 0.42 |
| P24468 | COUP transcription factor 2 (COUP-TF2) (Apolipoprotein A-I regulatory protein 1) (ARP-1) (COUP transcription factor II) (COUP-TF II) (Nuclear receptor subfamily 2 group F member 2) | EBI-21859075 | 0.35 |
| Q9UID3 | Vacuolar protein sorting-associated protein 51 homolog (Another new gene 2 protein) (Protein fat-free homolog) | EBI-16150241 | 0.35 |
| P36405 | ADP-ribosylation factor-like protein 3 | EBI-16180991 | 0.35 |
| O43615 | Mitochondrial import inner membrane translocase subunit TIM44 | EBI-16786283 | 0.27 |
| Q8IXI1 | Mitochondrial Rho GTPase 2 (MIRO-2) (hMiro-2) (EC 3.6.5.-) (Ras homolog gene family member T2) | EBI-16786283 | 0.42 |
| Q7Z434 | Mitochondrial antiviral-signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS-1) (Putative NF-kappa-B-activating protein 031N) (Virus-induced-signaling adapter) (VISA) | EBI-16786283 | 0.27 |
| P00403 | Cytochrome c oxidase subunit 2 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) | EBI-16786283 | 0.42 |
| O75431 | Metaxin-2 (Mitochondrial outer membrane import complex protein 2) | EBI-16786283 | 0.27 |
| Q9Y3D9 | 28S ribosomal protein S23, mitochondrial (MRP-S23) (S23mt) (Mitochondrial small ribosomal subunit protein mS23) | EBI-16786283 | 0.27 |
| Q9NVH1 | DnaJ homolog subfamily C member 11 | EBI-16786283 | 0.42 |
| Q9BYN8 | 28S ribosomal protein S26, mitochondrial (MRP-S26) (S26mt) (28S ribosomal protein S13, mitochondrial) (MRP-S13) (S13mt) (Mitochondrial small ribosomal subunit protein mS26) | EBI-16786283 | 0.27 |
| Q99618 | Cell division cycle-associated protein 3 (Gene-rich cluster protein C8) (Trigger of mitotic entry protein 1) (TOME-1) | EBI-16786283 | 0.27 |
| Q96EY7 | Pentatricopeptide repeat domain-containing protein 3, mitochondrial (28S ribosomal protein S39, mitochondrial) (MRP-S39) (Mitochondrial small ribosomal subunit protein mS39) (Transformation-related gene 15 protein) (TRG-15) | EBI-16786283 | 0.27 |
| Q8N4Q1 | Mitochondrial intermembrane space import and assembly protein 40 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 4) | EBI-16786283 | 0.42 |
| Q16891 | MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89) | EBI-16786283 | 0.42 |
| Q16775 | Hydroxyacylglutathione hydrolase, mitochondrial (EC 3.1.2.6) (Glyoxalase II) (Glx II) | EBI-16786283 | 0.27 |
| Q13011 | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (EC 5.3.3.-) | EBI-16786283 | 0.27 |
| Q02952 | A-kinase anchor protein 12 (AKAP-12) (A-kinase anchor protein 250 kDa) (AKAP 250) (Gravin) (Myasthenia gravis autoantigen) | EBI-16786283 | 0.27 |
| P82650 | 28S ribosomal protein S22, mitochondrial (MRP-S22) (S22mt) (Mitochondrial small ribosomal subunit protein mS22) | EBI-16786283 | 0.27 |
| P50454 | Serpin H1 (47 kDa heat shock protein) (Arsenic-transactivated protein 3) (AsTP3) (Cell proliferation-inducing gene 14 protein) (Collagen-binding protein) (Colligin) (Rheumatoid arthritis-related antigen RA-A47) | EBI-16786283 | 0.27 |
| P36542 | ATP synthase subunit gamma, mitochondrial (ATP synthase F1 subunit gamma) (F-ATPase gamma subunit) | EBI-16786283 | 0.42 |
| P18085 | ADP-ribosylation factor 4 | EBI-16786283 | 0.27 |
| P16615 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR Ca(2+)-ATPase 2) (EC 7.2.2.10) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) | EBI-16786283 | 0.27 |
| P13804 | Electron transfer flavoprotein subunit alpha, mitochondrial (Alpha-ETF) | EBI-16786283 | 0.27 |
| O95721 | Synaptosomal-associated protein 29 (SNAP-29) (Soluble 29 kDa NSF attachment protein) (Vesicle-membrane fusion protein SNAP-29) | EBI-16786283 | 0.27 |
| O76031 | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial | EBI-16786283 | 0.42 |
| O75683 | Surfeit locus protein 6 | EBI-16786283 | 0.27 |
| A8MXV4 | Acyl-coenzyme A diphosphatase NUDT19 (EC 3.6.1.-) (Nucleoside diphosphate-linked moiety X motif 19) (Nudix motif 19) | EBI-16786283 | 0.27 |
| Q9Y5L4 | Mitochondrial import inner membrane translocase subunit Tim13 | EBI-16786283 | 0.42 |
| Q9Y5J9 | Mitochondrial import inner membrane translocase subunit Tim8 B (DDP-like protein) (Deafness dystonia protein 2) | EBI-16786283 | 0.42 |
| Q9Y512 | Sorting and assembly machinery component 50 homolog (Transformation-related gene 3 protein) (TRG-3) | EBI-16786283 | 0.42 |
| Q9Y4W6 | AFG3-like protein 2 (EC 3.4.24.-) (Paraplegin-like protein) | EBI-16786283 | 0.27 |
| Q9Y2W6 | Tudor and KH domain-containing protein (Tudor domain-containing protein 2) | EBI-16786283 | 0.27 |
| Q9Y2S7 | Polymerase delta-interacting protein 2 (38 kDa DNA polymerase delta interaction protein) (p38) | EBI-16786283 | 0.42 |
| Q9Y2Q9 | 28S ribosomal protein S28, mitochondrial (MRP-S28) (S28mt) (28S ribosomal protein S35, mitochondrial) (MRP-S35) (S35mt) (Mitochondrial small ribosomal subunit protein bS1m) | EBI-16786283 | 0.27 |
| Q9ULX6 | A-kinase anchor protein 8-like (AKAP8-like protein) (Helicase A-binding protein 95) (HAP95) (Homologous to AKAP95 protein) (HA95) (Neighbor of A-kinase-anchoring protein 95) (Neighbor of AKAP95) | EBI-16786283 | 0.27 |
| Q9UJS0 | Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial (Calcium-binding mitochondrial carrier protein Aralar2) (ARALAR-related gene 2) (ARALAR2) (Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13) | EBI-16786283 | 0.27 |
| Q9P0J0 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Cell death regulatory protein GRIM-19) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic and interferon-induced mortality 19 protein) (GRIM-19) (Gene associated with retinoic and IFN-induced mortality 19 protein) (NADH-ubiquinone oxidoreductase B16.6 subunit) | EBI-16786283 | 0.42 |
| Q9P032 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 (Hormone-regulated proliferation-associated protein of 20 kDa) | EBI-16786283 | 0.27 |
| Q9NX63 | MICOS complex subunit MIC19 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 3) | EBI-16786283 | 0.27 |
| Q9NX40 | OCIA domain-containing protein 1 (Ovarian cancer immunoreactive antigen domain containing 1) (Ovarian carcinoma immunoreactive antigen) | EBI-16786283 | 0.27 |
| Q9NX14 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (Complex I-ESSS) (CI-ESSS) (NADH-ubiquinone oxidoreductase ESSS subunit) (Neuronal protein 17.3) (Np17.3) (p17.3) | EBI-16786283 | 0.27 |
| Q9NVI7 | ATPase family AAA domain-containing protein 3A | EBI-16786283 | 0.27 |
| Q9NSE4 | Isoleucine--tRNA ligase, mitochondrial (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) (IleRS) | EBI-16786283 | 0.42 |
| Q9NS69 | Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog) | EBI-16786283 | 0.27 |
| Q9NPL8 | Complex I assembly factor TIMMDC1, mitochondrial (Protein M5-14) (Translocase of inner mitochondrial membrane domain-containing protein 1) (TIMM domain containing-protein 1) | EBI-16786283 | 0.27 |
| Q9H845 | Complex I assembly factor ACAD9, mitochondrial (Acyl-CoA dehydrogenase family member 9) (ACAD-9) (EC 1.3.8.-) | EBI-16786283 | 0.27 |
| Q9H078 | Caseinolytic peptidase B protein homolog (EC 3.6.1.-) (Suppressor of potassium transport defect 3) | EBI-16786283 | 0.42 |
| Q9BW72 | HIG1 domain family member 2A, mitochondrial (RCF1 homolog B) (RCF1b) | EBI-16786283 | 0.27 |
| Q9BSH4 | Translational activator of cytochrome c oxidase 1 (Coiled-coil domain-containing protein 44) (Translational activator of mitochondrially-encoded cytochrome c oxidase I) | EBI-16786283 | 0.27 |
| Q9BPX6 | Calcium uptake protein 1, mitochondrial (Atopy-related autoantigen CALC) (ara CALC) (Calcium-binding atopy-related autoantigen 1) (allergen Hom s 4) | EBI-16786283 | 0.27 |
| Q99714 | 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-estradiol 17-dehydrogenase) (EC 1.1.1.62) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+))) (EC 1.1.1.239) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (3alpha(or 20beta)-hydroxysteroid dehydrogenase) (EC 1.1.1.53) (7-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.159) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH) | EBI-16786283 | 0.27 |
| Q96TA2 | ATP-dependent zinc metalloprotease YME1L1 (EC 3.4.24.-) (ATP-dependent metalloprotease FtsH1) (Meg-4) (Presenilin-associated metalloprotease) (PAMP) (YME1-like protein 1) | EBI-16786283 | 0.27 |
| Q96EX1 | Small integral membrane protein 12 | EBI-16786283 | 0.27 |
| Q96EL2 | 28S ribosomal protein S24, mitochondrial (MRP-S24) (S24mt) (Mitochondrial small ribosomal subunit protein uS3m) (bMRP-47) (bMRP47) | EBI-16786283 | 0.27 |
| Q96E52 | Metalloendopeptidase OMA1, mitochondrial (EC 3.4.24.-) (Metalloprotease-related protein 1) (MPRP-1) (Overlapping with the m-AAA protease 1 homolog) | EBI-16786283 | 0.41 |
| Q96C36 | Pyrroline-5-carboxylate reductase 2 (P5C reductase 2) (P5CR 2) (EC 1.5.1.2) | EBI-16786283 | 0.27 |
| Q96C01 | Protein FAM136A | EBI-16786283 | 0.27 |
| Q96BR5 | Cytochrome c oxidase assembly factor 7 (Beta-lactamase hcp-like protein) (Respiratory chain assembly factor 1) (Sel1 repeat-containing protein 1) | EBI-16786283 | 0.27 |
| Q96A73 | Putative monooxygenase p33MONOX (EC 1.-.-.-) (Brain-derived rescue factor p60MONOX) (Flavin monooxygenase motif-containing protein of 33 kDa) | EBI-16786283 | 0.27 |
| Q92667 | A-kinase anchor protein 1, mitochondrial (A-kinase anchor protein 149 kDa) (AKAP 149) (Dual specificity A-kinase-anchoring protein 1) (D-AKAP-1) (Protein kinase A-anchoring protein 1) (PRKA1) (Spermatid A-kinase anchor protein 84) (S-AKAP84) | EBI-16786283 | 0.27 |
| Q92665 | 28S ribosomal protein S31, mitochondrial (MRP-S31) (S31mt) (Imogen 38) (Mitochondrial small ribosomal subunit protein mS31) | EBI-16786283 | 0.27 |
| Q8IYU8 | Calcium uptake protein 2, mitochondrial (EF-hand domain-containing family member A1) | EBI-16786283 | 0.27 |
| Q8IUX1 | Complex I assembly factor TMEM126B, mitochondrial (Transmembrane protein 126B) | EBI-16786283 | 0.27 |
| Q86TX2 | Acyl-coenzyme A thioesterase 1 (Acyl-CoA thioesterase 1) (EC 3.1.2.-) (CTE-I) (CTE-Ib) (Inducible cytosolic acyl-coenzyme A thioester hydrolase) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (Palmitoyl-coenzyme A thioesterase) (EC 3.1.2.2) | EBI-16786283 | 0.27 |
| Q7L0Y3 | tRNA methyltransferase 10 homolog C (HBV pre-S2 trans-regulated protein 2) (Mitochondrial ribonuclease P protein 1) (Mitochondrial RNase P protein 1) (RNA (guanine-9-)-methyltransferase domain-containing protein 1) (Renal carcinoma antigen NY-REN-49) (mRNA methyladenosine-N(1)-methyltransferase) (EC 2.1.1.-) (tRNA (adenine(9)-N(1))-methyltransferase) (EC 2.1.1.218) (tRNA (guanine(9)-N(1))-methyltransferase) (EC 2.1.1.221) | EBI-16786283 | 0.27 |
| Q7KZN9 | Cytochrome c oxidase assembly protein COX15 homolog | EBI-16786283 | 0.27 |
| Q70CQ3 | Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.4.19.12) (Deubiquitinating enzyme 30) (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Ub-specific protease 30) | EBI-16786283 | 0.27 |
| Q6UB35 | Monofunctional C1-tetrahydrofolate synthase, mitochondrial (EC 6.3.4.3) (Formyltetrahydrofolate synthetase) | EBI-16786283 | 0.42 |
| Q6KCM7 | Calcium-binding mitochondrial carrier protein SCaMC-2 (Mitochondrial ATP-Mg/Pi carrier protein 3) (Mitochondrial Ca(2+)-dependent solute carrier protein 3) (Small calcium-binding mitochondrial carrier protein 2) (Solute carrier family 25 member 25) | EBI-16786283 | 0.27 |
| Q6DKK2 | Tetratricopeptide repeat protein 19, mitochondrial (TPR repeat protein 19) | EBI-16786283 | 0.42 |
| Q5TC12 | ATP synthase mitochondrial F1 complex assembly factor 1 (ATP11 homolog) | EBI-16786283 | 0.27 |
| Q5T9A4 | ATPase family AAA domain-containing protein 3B (AAA-TOB3) | EBI-16786283 | 0.27 |
| Q5JTJ3 | Cytochrome c oxidase assembly factor 6 homolog | EBI-16786283 | 0.27 |
| Q4VC31 | Protein MIX23 (Coiled-coil domain-containing protein 58) | EBI-16786283 | 0.27 |
| Q49B96 | Cytochrome c oxidase assembly protein COX19 (hCOX19) | EBI-16786283 | 0.27 |
| Q3ZCQ8 | Mitochondrial import inner membrane translocase subunit TIM50 | EBI-16786283 | 0.27 |
| Q16795 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial (Complex I-39kD) (CI-39kD) (NADH-ubiquinone oxidoreductase 39 kDa subunit) | EBI-16786283 | 0.27 |
| Q16740 | ATP-dependent Clp protease proteolytic subunit, mitochondrial (EC 3.4.21.92) (Endopeptidase Clp) | EBI-16786283 | 0.27 |
| Q16718 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (Complex I subunit B13) (Complex I-13kD-B) (CI-13kD-B) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit) | EBI-16786283 | 0.27 |
| Q14249 | Endonuclease G, mitochondrial (Endo G) (EC 3.1.30.-) | EBI-16786283 | 0.27 |
| Q14061 | Cytochrome c oxidase copper chaperone | EBI-16786283 | 0.27 |
| Q12849 | G-rich sequence factor 1 (GRSF-1) | EBI-16786283 | 0.27 |
| Q04837 | Single-stranded DNA-binding protein, mitochondrial (Mt-SSB) (MtSSB) (PWP1-interacting protein 17) | EBI-16786283 | 0.27 |
| P99999 | Cytochrome c | EBI-16786283 | 0.27 |
| P83111 | Serine beta-lactamase-like protein LACTB, mitochondrial (EC 3.4.-.-) | EBI-16786283 | 0.41 |
| P62072 | Mitochondrial import inner membrane translocase subunit Tim10 | EBI-16786283 | 0.27 |
| P61088 | Ubiquitin-conjugating enzyme E2 N (EC 2.3.2.23) (Bendless-like ubiquitin-conjugating enzyme) (E2 ubiquitin-conjugating enzyme N) (Ubc13) (UbcH13) (Ubiquitin carrier protein N) (Ubiquitin-protein ligase N) | EBI-16786283 | 0.27 |
| P56381 | ATP synthase subunit epsilon, mitochondrial (ATPase subunit epsilon) (ATP synthase F1 subunit epsilon) | EBI-16786283 | 0.27 |
| P56277 | Cx9C motif-containing protein 4 (Mature T-cell proliferation 1 neighbor protein) (Mature T-cell proliferation-1 type A) (MTCP-1 type A) (Protein p8 MTCP-1) (p8MTCP1) | EBI-16786283 | 0.27 |
| P53701 | Holocytochrome c-type synthase (EC 4.4.1.17) (Cytochrome c-type heme lyase) | EBI-16786283 | 0.27 |
| P51970 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 (Complex I-19kD) (CI-19kD) (Complex I-PGIV) (CI-PGIV) (NADH-ubiquinone oxidoreductase 19 kDa subunit) | EBI-16786283 | 0.42 |
| P49821 | NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (EC 7.1.1.2) (Complex I-51kD) (CI-51kD) (NADH dehydrogenase flavoprotein 1) (NADH-ubiquinone oxidoreductase 51 kDa subunit) | EBI-16786283 | 0.27 |
| P49753 | Acyl-coenzyme A thioesterase 2, mitochondrial (Acyl-CoA thioesterase 2) (EC 3.1.2.2) (Acyl-coenzyme A thioester hydrolase 2a) (CTE-Ia) (Long-chain acyl-CoA thioesterase 2) (ZAP128) | EBI-16786283 | 0.27 |
| P48047 | ATP synthase subunit O, mitochondrial (ATP synthase peripheral stalk subunit OSCP) (Oligomycin sensitivity conferral protein) (OSCP) | EBI-16786283 | 0.27 |
| P46199 | Translation initiation factor IF-2, mitochondrial (IF-2(Mt)) (IF-2Mt) (IF2(mt)) | EBI-16786283 | 0.27 |
| P38117 | Electron transfer flavoprotein subunit beta (Beta-ETF) | EBI-16786283 | 0.27 |
| P36957 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K) | EBI-16786283 | 0.27 |
| P36551 | Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial (COX) (Coprogen oxidase) (Coproporphyrinogenase) (EC 1.3.3.3) | EBI-16786283 | 0.27 |
| P35232 | Prohibitin 1 | EBI-16786283 | 0.27 |
| P34897 | Serine hydroxymethyltransferase, mitochondrial (SHMT) (EC 2.1.2.1) (Glycine hydroxymethyltransferase) (Serine methylase) | EBI-16786283 | 0.27 |
| P32322 | Pyrroline-5-carboxylate reductase 1, mitochondrial (P5C reductase 1) (P5CR 1) (EC 1.5.1.2) | EBI-16786283 | 0.27 |
| P31930 | Cytochrome b-c1 complex subunit 1, mitochondrial (Complex III subunit 1) (Core protein I) (Ubiquinol-cytochrome-c reductase complex core protein 1) | EBI-16786283 | 0.27 |
| P31040 | Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp) | EBI-16786283 | 0.27 |
| P30405 | Peptidyl-prolyl cis-trans isomerase F, mitochondrial (PPIase F) (EC 5.2.1.8) (Cyclophilin D) (CyP-D) (CypD) (Cyclophilin F) (Mitochondrial cyclophilin) (CyP-M) (Rotamase F) | EBI-16786283 | 0.27 |
| P28331 | NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (EC 7.1.1.2) (Complex I-75kD) (CI-75kD) | EBI-16786283 | 0.27 |
| P25705 | ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha) | EBI-16786283 | 0.27 |
| P24539 | ATP synthase F(0) complex subunit B1, mitochondrial (ATP synthase peripheral stalk-membrane subunit b) (ATP synthase proton-transporting mitochondrial F(0) complex subunit B1) (ATP synthase subunit b) (ATPase subunit b) | EBI-16786283 | 0.27 |
| P22695 | Cytochrome b-c1 complex subunit 2, mitochondrial (Complex III subunit 2) (Core protein II) (Ubiquinol-cytochrome-c reductase complex core protein 2) | EBI-16786283 | 0.27 |
| P20674 | Cytochrome c oxidase subunit 5A, mitochondrial (Cytochrome c oxidase polypeptide Va) | EBI-16786283 | 0.27 |
| P19404 | NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (EC 7.1.1.2) (NADH-ubiquinone oxidoreductase 24 kDa subunit) | EBI-16786283 | 0.27 |
| P19367 | Hexokinase-1 (EC 2.7.1.1) (Brain form hexokinase) (Hexokinase type I) (HK I) (Hexokinase-A) | EBI-16786283 | 0.27 |
| P18859 | ATP synthase-coupling factor 6, mitochondrial (ATPase subunit F6) (ATP synthase peripheral stalk subunit F6) | EBI-16786283 | 0.27 |
| P14854 | Cytochrome c oxidase subunit 6B1 (Cytochrome c oxidase subunit VIb isoform 1) (COX VIb-1) | EBI-16786283 | 0.42 |
| P13073 | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1) (COX IV-1) | EBI-16786283 | 0.27 |
| P10606 | Cytochrome c oxidase subunit 5B, mitochondrial (Cytochrome c oxidase polypeptide Vb) | EBI-16786283 | 0.27 |
| P10599 | Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) (allergen Hom s Trx) | EBI-16786283 | 0.42 |
| P09669 | Cytochrome c oxidase subunit 6C (Cytochrome c oxidase polypeptide VIc) | EBI-16786283 | 0.27 |
| P08574 | Cytochrome c1, heme protein, mitochondrial (EC 7.1.1.8) (Complex III subunit 4) (Complex III subunit IV) (Cytochrome b-c1 complex subunit 4) (Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit) (Cytochrome c-1) | EBI-16786283 | 0.27 |
| P07919 | Cytochrome b-c1 complex subunit 6, mitochondrial (Complex III subunit 6) (Complex III subunit VIII) (Cytochrome c1 non-heme 11 kDa protein) (Mitochondrial hinge protein) (Ubiquinol-cytochrome c reductase complex 11 kDa protein) | EBI-16786283 | 0.27 |
| P06576 | ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) (ATP synthase F1 subunit beta) | EBI-16786283 | 0.27 |
| P05023 | Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1) | EBI-16786283 | 0.27 |
| P00367 | Glutamate dehydrogenase 1, mitochondrial (GDH 1) (EC 1.4.1.3) | EBI-16786283 | 0.27 |
| O96008 | Mitochondrial import receptor subunit TOM40 homolog (Protein Haymaker) (Translocase of outer membrane 40 kDa subunit homolog) (p38.5) | EBI-16786283 | 0.42 |
| O96000 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (Complex I-PDSW) (CI-PDSW) (NADH-ubiquinone oxidoreductase PDSW subunit) | EBI-16786283 | 0.27 |
| O95202 | Mitochondrial proton/calcium exchanger protein (Leucine zipper-EF-hand-containing transmembrane protein 1) | EBI-16786283 | 0.27 |
| O94925 | Glutaminase kidney isoform, mitochondrial (GLS) (EC 3.5.1.2) (K-glutaminase) (L-glutamine amidohydrolase) [Cleaved into: Glutaminase kidney isoform, mitochondrial 68 kDa chain; Glutaminase kidney isoform, mitochondrial 65 kDa chain] | EBI-16786283 | 0.27 |
| O94826 | Mitochondrial import receptor subunit TOM70 (Mitochondrial precursor proteins import receptor) (Translocase of outer membrane 70 kDa subunit) (Translocase of outer mitochondrial membrane protein 70) | EBI-16786283 | 0.27 |
| O75964 | ATP synthase subunit g, mitochondrial (ATPase subunit g) (ATP synthase membrane subunit g) | EBI-16786283 | 0.27 |
| O75947 | ATP synthase subunit d, mitochondrial (ATPase subunit d) (ATP synthase peripheral stalk subunit d) | EBI-16786283 | 0.27 |
| O75746 | Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial (Araceli hiperlarga) (Aralar) (Aralar1) (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) | EBI-16786283 | 0.27 |
| O75616 | GTPase Era, mitochondrial (H-ERA) (hERA) (Conserved ERA-like GTPase) (CEGA) (ERA-W) (ERA-like protein 1) | EBI-16786283 | 0.42 |
| O75489 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial (EC 7.1.1.2) (Complex I-30kD) (CI-30kD) (NADH-ubiquinone oxidoreductase 30 kDa subunit) | EBI-16786283 | 0.27 |
| O75380 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial (Complex I-13kD-A) (CI-13kD-A) (NADH-ubiquinone oxidoreductase 13 kDa-A subunit) | EBI-16786283 | 0.27 |
| O75306 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial (EC 7.1.1.2) (Complex I-49kD) (CI-49kD) (NADH-ubiquinone oxidoreductase 49 kDa subunit) | EBI-16786283 | 0.27 |
| O60313 | Dynamin-like 120 kDa protein, mitochondrial (EC 3.6.5.5) (Optic atrophy protein 1) [Cleaved into: Dynamin-like 120 kDa protein, form S1] | EBI-16786283 | 0.27 |
| O60220 | Mitochondrial import inner membrane translocase subunit Tim8 A (Deafness dystonia protein 1) (X-linked deafness dystonia protein) | EBI-16786283 | 0.42 |
| O43819 | Protein SCO2 homolog, mitochondrial | EBI-16786283 | 0.42 |
| O43715 | TP53-regulated inhibitor of apoptosis 1 (Protein 15E1.1) (WF-1) (p53-inducible cell-survival factor) (p53CSV) | EBI-16786283 | 0.27 |
| O43464 | Serine protease HTRA2, mitochondrial (EC 3.4.21.108) (High temperature requirement protein A2) (HtrA2) (Omi stress-regulated endoprotease) (Serine protease 25) (Serine proteinase OMI) | EBI-16786283 | 0.41 |
| O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | EBI-16786283 | 0.27 |
| O00217 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (EC 7.1.1.2) (Complex I-23kD) (CI-23kD) (NADH-ubiquinone oxidoreductase 23 kDa subunit) (TYKY subunit) | EBI-16786283 | 0.27 |
| Q69YU5 | Protein BRAWNIN | EBI-16786283 | 0.27 |
| P27694 | Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) [Cleaved into: Replication protein A 70 kDa DNA-binding subunit, N-terminally processed] | EBI-16786589 | 0.35 |
| P35244 | Replication protein A 14 kDa subunit (RP-A p14) (Replication factor A protein 3) (RF-A protein 3) | EBI-16786589 | 0.35 |
| P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | EBI-16786589 | 0.35 |
| Q9UHB6 | LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) | EBI-16786589 | 0.35 |
| Q9BSD7 | Cancer-related nucleoside-triphosphatase (NTPase) (EC 3.6.1.15) (Nucleoside triphosphate phosphohydrolase) | EBI-16786589 | 0.35 |
| Q96HS1 | Serine/threonine-protein phosphatase PGAM5, mitochondrial (EC 3.1.3.16) (Bcl-XL-binding protein v68) (Phosphoglycerate mutase family member 5) | EBI-16786589 | 0.35 |
| Q6PI48 | Aspartate--tRNA ligase, mitochondrial (EC 6.1.1.12) (Aspartyl-tRNA synthetase) (AspRS) | EBI-16786589 | 0.35 |
| Q10713 | Mitochondrial-processing peptidase subunit alpha (Alpha-MPP) (Inactive zinc metalloprotease alpha) (P-55) | EBI-16786589 | 0.35 |
| P49411 | Elongation factor Tu, mitochondrial (EF-Tu) (P43) | EBI-16786589 | 0.35 |
| P18887 | DNA repair protein XRCC1 (X-ray repair cross-complementing protein 1) | EBI-16786589 | 0.35 |
| P0DMV8 | Heat shock 70 kDa protein 1A (Heat shock 70 kDa protein 1) (HSP70-1) (HSP70.1) | EBI-16786589 | 0.35 |
| P00374 | Dihydrofolate reductase (EC 1.5.1.3) | EBI-16786589 | 0.35 |
| O43813 | Glutathione S-transferase LANCL1 (EC 2.5.1.18) (40 kDa erythrocyte membrane protein) (p40) (LanC-like protein 1) | EBI-16786589 | 0.35 |
| P45880 | Voltage-dependent anion-selective channel protein 2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2) | EBI-16786589 | 0.35 |
| Q02539 | Histone H1.1 (Histone H1a) | EBI-16786761 | 0.27 |
| P53004 | Biliverdin reductase A (BVR A) (EC 1.3.1.24) (Biliverdin-IX alpha-reductase) | EBI-16786761 | 0.27 |
| Q9HAV7 | GrpE protein homolog 1, mitochondrial (HMGE) (Mt-GrpE#1) | EBI-16786761 | 0.27 |
| Q9H0I3 | Coiled-coil domain-containing protein 113 | EBI-16786761 | 0.27 |
| Q92522 | Histone H1.10 (Histone H1x) | EBI-16786761 | 0.27 |
| P83881 | 60S ribosomal protein L36a (60S ribosomal protein L44) (Cell growth-inhibiting gene 15 protein) (Cell migration-inducing gene 6 protein) (Large ribosomal subunit protein eL42) | EBI-16786761 | 0.27 |
| P61604 | 10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (Chaperonin 10) (CPN10) (Early-pregnancy factor) (EPF) | EBI-16786761 | 0.27 |
| P09622 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein) | EBI-20304669 | 0.35 |
| P08559 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) | EBI-20306509 | 0.35 |
| P35610 | Sterol O-acyltransferase 1 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 1) (ACAT-1) (Cholesterol acyltransferase 1) | EBI-20307233 | 0.35 |
| P21796 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) | EBI-20307902 | 0.35 |
| Q9UI95 | Mitotic spindle assembly checkpoint protein MAD2B (Mitotic arrest deficient 2-like protein 2) (MAD2-like protein 2) (REV7 homolog) (hREV7) | EBI-20219138 | 0.35 |
| P51957 | Serine/threonine-protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A-related kinase 4) (NimA-related protein kinase 4) (Serine/threonine-protein kinase 2) (Serine/threonine-protein kinase NRK2) | EBI-20721387 | 0.35 |
| Q8IYE1 | Coiled-coil domain-containing protein 13 | EBI-20902736 | 0.40 |
| Q9HCD5 | Nuclear receptor coactivator 5 (NCoA-5) (Coactivator independent of AF-2) (CIA) | EBI-20905384 | 0.40 |
| O75311 | Glycine receptor subunit alpha-3 | EBI-20905664 | 0.40 |
| P08621 | U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70 kDa) (U1-70K) (snRNP70) | EBI-20907472 | 0.40 |
| Q86X27 | Ras-specific guanine nucleotide-releasing factor RalGPS2 (Ral GEF with PH domain and SH3-binding motif 2) (RalA exchange factor RalGPS2) | EBI-20908104 | 0.40 |
| Q9Y6X8 | Zinc fingers and homeoboxes protein 2 (Alpha-fetoprotein regulator 1) (AFP regulator 1) (Regulator of AFP) (Zinc finger and homeodomain protein 2) | EBI-20910808 | 0.40 |
| Q9H2G2 | STE20-like serine/threonine-protein kinase (STE20-like kinase) (hSLK) (EC 2.7.11.1) (CTCL tumor antigen se20-9) (STE20-related serine/threonine-protein kinase) (STE20-related kinase) (Serine/threonine-protein kinase 2) | EBI-20932552 | 0.40 |
| Q13061 | Triadin | EBI-20932784 | 0.40 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q9BZR8 | Apoptosis facilitator Bcl-2-like protein 14 (Bcl2-L-14) (Apoptosis regulator Bcl-G) | EBI-21258469 | 0.35 |
| Q8IY21 | Probable ATP-dependent RNA helicase DDX60 (EC 3.6.4.13) (DEAD box protein 60) | EBI-21259607 | 0.35 |
| F5H1C8 | Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a) | EBI-21264930 | 0.35 |
| Q9H1C4 | Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1) | EBI-21266770 | 0.35 |
| P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-21132308 | 0.35 |
| O60260 | E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2) | EBI-21135687 | 0.35 |
| Q13153 | Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK) | EBI-25379067 | 0.35 |
| Q05513 | Protein kinase C zeta type (EC 2.7.11.13) (nPKC-zeta) | EBI-25380056 | 0.35 |
| Q13322 | Growth factor receptor-bound protein 10 (GRB10 adapter protein) (Insulin receptor-binding protein Grb-IR) | EBI-25382050 | 0.35 |
| P04049 | RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1) | EBI-25382473 | 0.35 |
| Q13547 | Histone deacetylase 1 (HD1) (EC 3.5.1.98) (Protein deacetylase HDAC1) (EC 3.5.1.-) (Protein decrotonylase HDAC1) (EC 3.5.1.-) | EBI-25394148 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| P69479 | Phosphoprotein (Protein P) (Protein M1) | EBI-25568051 | 0.35 |
| Q5EP34 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-25772822 | 0.61 |
| C3W5S0 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-26452157 | 0.35 |
| P15659 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-26452167 | 0.35 |
| Q6DNN3 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-25773258 | 0.35 |
| Q6DNT7 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) | EBI-25773258 | 0.35 |
| Q8TB24 | Ras and Rab interactor 3 (Ras interaction/interference protein 3) | EBI-26518569 | 0.35 |
| Q6ZNK6 | TRAF-interacting protein with FHA domain-containing protein B (TIFA-like protein) | EBI-26453464 | 0.35 |
| O60303 | Katanin-interacting protein | EBI-26582514 | 0.35 |
| P34972 | Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5) | EBI-26880846 | 0.35 |
| Q96T52 | Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein) | EBI-27049069 | 0.27 |
| Q96LU5 | Mitochondrial inner membrane protease subunit 1 (EC 3.4.21.-) (IMP1-like protein) | EBI-27049466 | 0.27 |
| Q9H300 | Presenilins-associated rhomboid-like protein, mitochondrial (EC 3.4.21.105) (Mitochondrial intramembrane cleaving protease PARL) [Cleaved into: P-beta (Pbeta)] | EBI-27049982 | 0.27 |
| Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-27111302 | 0.35 |
| Q8NCK7 | Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11) | EBI-27103180 | 0.35 |
| A4FU01 | Myotubularin-related protein 11 (Cisplatin resistance-associated protein) (hCRA) (Inactive phosphatidylinositol 3-phosphatase 11) | EBI-27113520 | 0.35 |
| Q99952 | Tyrosine-protein phosphatase non-receptor type 18 (EC 3.1.3.48) (Brain-derived phosphatase) | EBI-27114698 | 0.35 |
| Q9Y603 | Transcription factor ETV7 (ETS translocation variant 7) (ETS-related protein Tel2) (Tel-related Ets factor) (Transcription factor Tel-2) | EBI-29000341 | 0.35 |
| P41162 | ETS translocation variant 3 (ETS domain transcriptional repressor PE1) (PE-1) (Mitogenic Ets transcriptional suppressor) | EBI-29000231 | 0.35 |
| P48742 | LIM/homeobox protein Lhx1 (LIM homeobox protein 1) (Homeobox protein Lim-1) (hLim-1) | EBI-29000712 | 0.35 |
| Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.35 |
| O95600 | Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741) | EBI-29020196 | 0.35 |
| Q86V87 | FHF complex subunit HOOK interacting protein 2B (FHIP2B) (Retinoic acid-induced protein 16) | EBI-34575191 | 0.27 |
Database | Links |
| UNIPROT | O95831 A4QPB4 B1ALN1 B2RB08 D3DTE9 E9PRR0 Q1L6K4 Q1L6K6 Q2QKE4 Q5JUZ7 Q6I9X6 Q9Y3I3 Q9Y3I4 |
| PDB | 1M6I 4BUR 4BV6 4FDC 4LII 5FMH 5FS6 5FS7 5FS8 5FS9 5KVH 5KVI |
| Pfam | PF14721 PF07992 |
| OMIM | 300169 300232 300614 300816 310490 |
| DisGeNET | 9131 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory