Protein Information |
|
|---|---|
| Protein Name | DnaJ homolog subfamily A member 1 |
| Accession Code | P31689 |
| Gene | DNAJA1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 397) | |
|
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGG FGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQI RIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRL IIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS |
|
Structure Viewer (PDB: 2LO1) |
|---|
Description |
||
|---|---|---|
| Membrane {Curator InferencePubMed:10816573}; Lipid- anchor {Curator InferencePubMed:10816573}. Cytoplasm {Experimental EvidencePubMed:10816573}. Microsome {ECO:0000250}. Nucleus {Experimental EvidencePubMed:10816573}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:10816573}. Mitochondrion {ECO:0000250}. Note=Primarily associated with microsomes. A minor proportion is associated with mitochondria (By similarity). Primarily cytoplasmic. A minor proportion is associated with nuclei. {ECO:0000250}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Lipid-Anchored | UniProt | Experimental Evidence {ECO:0000269|PubMed:14752510,} | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytoplasmic Side Of Endoplasmic Reticulum Membrane (GO:0098554) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Membrane (GO:0016020) Microtubule Cytoskeleton (GO:0015630) Mitochondrion (GO:0005739) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Interactions with Nuclear Envelope proteins (13 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A0A142I5B9 | RNA-directed RNA polymerase NS5 | EBI-20625330 | 0.35 |
| O43542 | DNA repair protein XRCC3 | EBI-11129266 | 0.35 |
| P00533 | Epidermal growth factor receptor | EBI-702075 | 0.35 |
| P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-8770853 | 0.53 |
| P05129 | Protein kinase C gamma type | EBI-25379555 | 0.35 |
| P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-25509375 | 0.35 |
| P35240 | Merlin | EBI-6911783 | 0.35 |
| Q6ZMQ8 | Serine/threonine-protein kinase LMTK1 | EBI-10101253 | 0.35 |
| P53671 | LIM domain kinase 2 | EBI-10103591 | 0.35 |
| Q9WMX2 | RNA-directed RNA polymerase | EBI-11513409 | 0.35 |
| Q02156 | Protein kinase C epsilon type | EBI-25378052 | 0.35 |
| O95831 | Apoptosis-inducing factor 1, mitochondrial | EBI-16786283 | 0.27 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 | Interactions with other proteins (183 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q9Y333 | U6 snRNA-associated Sm-like protein LSm2 (Protein G7b) (Small nuclear ribonuclear protein D homolog) (snRNP core Sm-like protein Sm-x5) | EBI-348751 | 0.00 |
| Q13233 | Mitogen-activated protein kinase kinase kinase 1 (EC 2.7.11.25) (MAPK/ERK kinase kinase 1) (MEK kinase 1) (MEKK 1) | EBI-361839 | 0.00 |
| Q99759 | Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3) | EBI-362154 | 0.00 |
| Q00653 | Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor KBF2) (H2TF1) (Lymphocyte translocation chromosome 10 protein) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2) (Oncogene Lyt-10) (Lyt10) [Cleaved into: Nuclear factor NF-kappa-B p52 subunit] | EBI-362743 | 0.00 |
| Q99558 | Mitogen-activated protein kinase kinase kinase 14 (EC 2.7.11.25) (NF-kappa-beta-inducing kinase) (HsNIK) (Serine/threonine-protein kinase NIK) | EBI-362977 | 0.00 |
| Q04206 | Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3) | EBI-363259 | 0.00 |
| Q13546 | Receptor-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (Cell death protein RIP) (Receptor-interacting protein 1) (RIP-1) | EBI-363616 | 0.00 |
| Q9Y572 | Receptor-interacting serine/threonine-protein kinase 3 (EC 2.7.11.1) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3) | EBI-363772 | 0.00 |
| Q15750 | TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 1) (TGF-beta-activated kinase 1-binding protein 1) (TAK1-binding protein 1) | EBI-363982 | 0.00 |
| Q9NYJ8 | TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 2) (TAK1-binding protein 2) (TAB-2) (TGF-beta-activated kinase 1-binding protein 2) | EBI-364051 | 0.00 |
| O43318 | Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1) | EBI-364144 | 0.00 |
| P19438 | Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A, membrane form; Tumor necrosis factor-binding protein 1 (TBPI)] | EBI-364369 | 0.00 |
| P20333 | Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2 (TBP-2) (TBPII)] | EBI-364603 | 0.00 |
| Q15628 | Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain) | EBI-364837 | 0.00 |
| Q13077 | TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6) | EBI-364942 | 0.00 |
| Q12933 | TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3) | EBI-365035 | 0.00 |
| Q9Y4K3 | TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6) | EBI-365134 | 0.00 |
| A0JLT2 | Mediator of RNA polymerase II transcription subunit 19 (Lung cancer metastasis-related protein 1) (Mediator complex subunit 19) | EBI-394580 | 0.35 |
| Q9NX70 | Mediator of RNA polymerase II transcription subunit 29 (Intersex-like protein) (Mediator complex subunit 29) | EBI-394875 | 0.35 |
| Q8IXH7 | Negative elongation factor C/D (NELF-C/D) (TH1-like protein) | EBI-733541 | 0.00 |
| P49703 | ADP-ribosylation factor-like protein 4D (ADP-ribosylation factor-like protein 4L) | EBI-733840 | 0.00 |
| P19256 | Lymphocyte function-associated antigen 3 (Ag3) (Surface glycoprotein LFA-3) (CD antigen CD58) | EBI-734132 | 0.00 |
| P30408 | Transmembrane 4 L6 family member 1 (Membrane component chromosome 3 surface marker 1) (Tumor-associated antigen L6) | EBI-736034 | 0.00 |
| Q9UM11 | Fizzy-related protein homolog (Fzr) (CDC20-like protein 1) (Cdh1/Hct1 homolog) (hCDH1) | EBI-736796 | 0.00 |
| Q9NPF4 | tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (O-sialoglycoprotein endopeptidase) (hOSGEP) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEP) (tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP) | EBI-1062592 | 0.00 |
| O75365 | Protein tyrosine phosphatase type IVA 3 (EC 3.1.3.48) (PRL-R) (Protein-tyrosine phosphatase 4a3) (Protein-tyrosine phosphatase of regenerating liver 3) (PRL-3) | EBI-1068254 | 0.00 |
| O00422 | Histone deacetylase complex subunit SAP18 (18 kDa Sin3-associated polypeptide) (2HOR0202) (Cell growth-inhibiting gene 38 protein) (Sin3-associated polypeptide p18) | EBI-1076324 | 0.00 |
| P31930 | Cytochrome b-c1 complex subunit 1, mitochondrial (Complex III subunit 1) (Core protein I) (Ubiquinol-cytochrome-c reductase complex core protein 1) | EBI-1078266 | 0.00 |
| Q9Y2Q3 | Glutathione S-transferase kappa 1 (EC 2.5.1.18) (GST 13-13) (GST class-kappa) (GSTK1-1) (hGSTK1) (Glutathione S-transferase subunit 13) | EBI-1081237 | 0.00 |
| Q92956 | Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270) | EBI-1082988 | 0.00 |
| P01889 | HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B) | EBI-1083927 | 0.00 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-1171566 | 0.64 |
| Q9H9G7 | Protein argonaute-3 (Argonaute3) (hAgo3) (EC 3.1.26.n2) (Argonaute RISC catalytic component 3) (Eukaryotic translation initiation factor 2C 3) (eIF-2C 3) (eIF2C 3) | EBI-2267899 | 0.35 |
| Q9HCK5 | Protein argonaute-4 (Argonaute4) (hAgo4) (Argonaute RISC catalytic component 4) (Eukaryotic translation initiation factor 2C 4) (eIF-2C 4) (eIF2C 4) | EBI-2269711 | 0.35 |
| P99024 | Tubulin beta-5 chain | EBI-2555184 | 0.40 |
| P05213 | Tubulin alpha-1B chain (EC 3.6.5.-) (Alpha-tubulin 2) (Alpha-tubulin isotype M-alpha-2) (Tubulin alpha-2 chain) [Cleaved into: Detyrosinated tubulin alpha-1B chain] | EBI-2558640 | 0.40 |
| Q9Z1B5 | Mitotic spindle assembly checkpoint protein MAD2A (Mitotic arrest deficient 2-like protein 1) (MAD2-like protein 1) | EBI-2560653 | 0.40 |
| P83887 | Tubulin gamma-1 chain (Gamma-1-tubulin) (Gamma-tubulin complex component 1) (GCP-1) | EBI-2561869 | 0.40 |
| P68372 | Tubulin beta-4B chain (Tubulin beta-2C chain) | EBI-2562208 | 0.40 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| Q9H492 | Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha) | EBI-3044058 | 0.35 |
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-3046676 | 0.35 |
| O95166 | Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46) | EBI-3050465 | 0.35 |
| P15822 | Zinc finger protein 40 (Cirhin interaction protein) (CIRIP) (Gate keeper of apoptosis-activating protein) (GAAP) (Human immunodeficiency virus type I enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex-binding protein 1) (MBP-1) (Positive regulatory domain II-binding factor 1) (PRDII-BF1) | EBI-3930535 | 0.37 |
| Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | EBI-3930976 | 0.37 |
| Q15051 | IQ calmodulin-binding motif-containing protein 1 (Nephrocystin-5) (p53 and DNA damage-regulated IQ motif protein) (PIQ) | EBI-4286917 | 0.35 |
| P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-4310841 | 0.35 |
| Q9Y276 | Mitochondrial chaperone BCS1 (h-BCS1) (BCS1-like protein) | EBI-7104167 | 0.37 |
| P51636 | Caveolin-2 | EBI-7110722 | 0.37 |
| P35914 | Hydroxymethylglutaryl-CoA lyase, mitochondrial (HL) (HMG-CoA lyase) (EC 4.1.3.4) (3-hydroxy-3-methylglutarate-CoA lyase) | EBI-7174982 | 0.37 |
| O95989 | Diphosphoinositol polyphosphate phosphohydrolase 1 (DIPP-1) (EC 3.6.1.52) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1) (EC 3.6.1.-) (Nucleoside diphosphate-linked moiety X motif 3) (Nudix motif 3) | EBI-7273627 | 0.37 |
| Q9GZX7 | Single-stranded DNA cytosine deaminase (EC 3.5.4.38) (Activation-induced cytidine deaminase) (AID) (Cytidine aminohydrolase) | EBI-7553697 | 0.50 |
| P0DOE9 | Non-structural protein 1 (NS1) (Non-structural protein 1C) | EBI-6138583 | 0.35 |
| Q8JPQ9 | Non-structural protein NS-S | EBI-6159460 | 0.35 |
| Q77M19 | V protein | EBI-6270503 | 0.35 |
| Q13616 | Cullin-1 (CUL-1) | EBI-21323857 | 0.35 |
| Q13617 | Cullin-2 (CUL-2) | EBI-21327106 | 0.35 |
| Q13620 | Cullin-4B (CUL-4B) | EBI-21327757 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q93034 | Cullin-5 (CUL-5) (Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1) | EBI-21331078 | 0.35 |
| Q92769 | Histone deacetylase 2 (HD2) (EC 3.5.1.98) (Protein deacylase HDAC2) (EC 3.5.1.-) | EBI-6597828 | 0.35 |
| Q9UBN7 | Histone deacetylase 6 (HD6) (EC 3.5.1.98) (Tubulin-lysine deacetylase HDAC6) (EC 3.5.1.-) | EBI-6597993 | 0.53 |
| Q969S8 | Polyamine deacetylase HDAC10 (EC 3.5.1.48) (EC 3.5.1.62) (Histone deacetylase 10) (HD10) | EBI-6598258 | 0.35 |
| Q96DB2 | Histone deacetylase 11 (HD11) (EC 3.5.1.98) | EBI-6598272 | 0.35 |
| Q7Z6J6 | FERM domain-containing protein 5 | EBI-6911571 | 0.35 |
| Q15334 | Lethal(2) giant larvae protein homolog 1 (LLGL) (DLG4) (Hugl-1) (Human homolog to the D-lgl gene protein) | EBI-6911667 | 0.35 |
| P21860 | Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3) | EBI-8770321 | 0.35 |
| P34969 | 5-hydroxytryptamine receptor 7 (5-HT-7) (5-HT7) (5-HT-X) (Serotonin receptor 7) | EBI-9027817 | 0.35 |
| Q8WW22 | DnaJ homolog subfamily A member 4 | EBI-9393722 | 0.35 |
| Q96BE0 | Heat shock protein family A (Hsp70) member 8b | EBI-9394503 | 0.35 |
| Q9Y266 | Nuclear migration protein nudC (Nuclear distribution protein C homolog) | EBI-9395024 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-9515510 | 0.53 |
| Q16659 | Mitogen-activated protein kinase 6 (MAP kinase 6) (MAPK 6) (EC 2.7.11.24) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97-MAPK) | EBI-12502733 | 0.35 |
| P57078 | Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase) | EBI-12503575 | 0.35 |
| Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-10049645 | 0.35 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-9996267 | 0.35 |
| P10398 | Serine/threonine-protein kinase A-Raf (EC 2.7.11.1) (Proto-oncogene A-Raf) (Proto-oncogene A-Raf-1) (Proto-oncogene Pks) | EBI-10101587 | 0.35 |
| Q13418 | Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK) | EBI-10103376 | 0.35 |
| P51617 | Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1) | EBI-10103481 | 0.53 |
| P04049 | RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1) | EBI-10104226 | 0.35 |
| Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770028 | 0.35 |
| P03179 | Major tegument protein (MTP) (Protein p140) | EBI-11721697 | 0.35 |
| P03220 | Protein BGLF3 | EBI-11722152 | 0.35 |
| P03225 | Protein BDLF2 | EBI-11722220 | 0.35 |
| P06463 | Protein E6 | EBI-11724048 | 0.35 |
| P0CK49 | Tegument protein UL51 homolog | EBI-11725356 | 0.35 |
| P0CK56 | Uncharacterized protein BDLF4 | EBI-11725466 | 0.35 |
| P0CK58 | Apoptosis regulator BALF1 | EBI-11732874 | 0.35 |
| P30119 | Uncharacterized protein BTRF1 | EBI-11733103 | 0.35 |
| P69901 | Probable protein E5B | EBI-11733364 | 0.35 |
| Q2MG95 | BVLF1 | EBI-11733653 | 0.35 |
| Q69117 | Tripartite terminase subunit 2 | EBI-11733954 | 0.35 |
| P05214 | Tubulin alpha-3 chain (EC 3.6.5.-) (Alpha-tubulin 3/7) (Alpha-tubulin isotype M-alpha-3/7) (Tubulin alpha-3/alpha-7 chain) [Cleaved into: Detyrosinated tubulin alpha-3 chain] | EBI-10992821 | 0.35 |
| P35550 | rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (Histone-glutamine methyltransferase) (Nucleolar protein 1) (U6 snRNA 2'-O-methyltransferase fibrillarin) | EBI-11044604 | 0.35 |
| Q9BQE3 | Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain] | EBI-11139064 | 0.35 |
| O75665 | Centriole and centriolar satellite protein OFD1 (Oral-facial-digital syndrome 1 protein) (Protein 71-7A) | EBI-11365691 | 0.27 |
| Q15468 | SCL-interrupting locus protein (TAL-1-interrupting locus protein) | EBI-11383475 | 0.27 |
| Q92834 | X-linked retinitis pigmentosa GTPase regulator | EBI-11394826 | 0.27 |
| Q9C0F1 | Centrosomal protein of 44 kDa (Cep44) (HBV PreS1-transactivated protein 3) (PS1TP3) | EBI-11397104 | 0.27 |
| Q9NXB0 | Tectonic-like complex member MKS1 (Meckel syndrome type 1 protein) | EBI-11397893 | 0.27 |
| Q14CZ7 | FAST kinase domain-containing protein 3, mitochondrial | EBI-11426979 | 0.35 |
| Q13509 | Tubulin beta-3 chain (Tubulin beta-4 chain) (Tubulin beta-III) | EBI-11897134 | 0.35 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-11897791 | 0.57 |
| P56945 | Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas) | EBI-15099384 | 0.35 |
| O14829 | Serine/threonine-protein phosphatase with EF-hands 1 (PPEF-1) (EC 3.1.3.16) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine-protein phosphatase 7) (PP7) | EBI-14024386 | 0.35 |
| Q9Y2T4 | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (IMYPNO1) (PP2A subunit B isoform B55-gamma) (PP2A subunit B isoform PR55-gamma) (PP2A subunit B isoform R2-gamma) (PP2A subunit B isoform gamma) | EBI-14027932 | 0.42 |
| Q8IVT5 | Kinase suppressor of Ras 1 (EC 2.7.11.1) | EBI-14035664 | 0.35 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
| Q05322 | Membrane-associated protein VP24 (Ebola VP24) (eVP24) | EBI-15481401 | 0.35 |
| Q9BXB4 | Oxysterol-binding protein-related protein 11 (ORP-11) (OSBP-related protein 11) | EBI-21817602 | 0.35 |
| Q96SU4 | Oxysterol-binding protein-related protein 9 (ORP-9) (OSBP-related protein 9) | EBI-21817602 | 0.35 |
| Q14249 | Endonuclease G, mitochondrial (Endo G) (EC 3.1.30.-) | EBI-21817602 | 0.35 |
| O95714 | E3 ubiquitin-protein ligase HERC2 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 2) (HECT-type E3 ubiquitin transferase HERC2) | EBI-21817602 | 0.35 |
| P54645 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 (AMPK subunit alpha-1) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) (Tau-protein kinase PRKAA1) (EC 2.7.11.26) | EBI-16361875 | 0.35 |
| P80386 | 5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb) (5'-AMP-activated protein kinase 40 kDa subunit) | EBI-16362252 | 0.35 |
| Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-16686997 | 0.35 |
| Q6ZNJ1 | Neurobeachin-like protein 2 | EBI-16749633 | 0.35 |
| Q9H9B4 | Sideroflexin-1 | EBI-16799442 | 0.27 |
| P09622 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein) | EBI-20304669 | 0.35 |
| O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | EBI-20305770 | 0.35 |
| P08559 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) | EBI-20306509 | 0.35 |
| Q86U44 | N6-adenosine-methyltransferase catalytic subunit (EC 2.1.1.348) (Methyltransferase-like protein 3) (hMETTL3) (N6-adenosine-methyltransferase 70 kDa subunit) (MT-A70) | EBI-20594935 | 0.35 |
| Q9HCE5 | N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14) | EBI-20595531 | 0.35 |
| P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-20799058 | 0.35 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21022882 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q9Y251 | Heparanase (EC 3.2.1.166) (Endo-glucoronidase) (Heparanase-1) (Hpa1) [Cleaved into: Heparanase 8 kDa subunit; Heparanase 50 kDa subunit] | EBI-21260107 | 0.35 |
| Q9HC29 | Nucleotide-binding oligomerization domain-containing protein 2 (Caspase recruitment domain-containing protein 15) (Inflammatory bowel disease protein 1) | EBI-21262102 | 0.35 |
| Q15077 | P2Y purinoceptor 6 (P2Y6) | EBI-21262943 | 0.35 |
| P03427 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-21268420 | 0.35 |
| P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-21132308 | 0.35 |
| P49768 | Presenilin-1 (PS-1) (EC 3.4.23.-) (Protein S182) [Cleaved into: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] | EBI-21132675 | 0.35 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-21132926 | 0.67 |
| Q16526 | Cryptochrome-1 | EBI-21981854 | 0.35 |
| O15524 | Suppressor of cytokine signaling 1 (SOCS-1) (JAK-binding protein) (JAB) (STAT-induced STAT inhibitor 1) (SSI-1) (Tec-interacting protein 3) (TIP-3) | EBI-25373793 | 0.35 |
| Q13163 | Dual specificity mitogen-activated protein kinase kinase 5 (MAP kinase kinase 5) (MAPKK 5) (EC 2.7.12.2) (MAPK/ERK kinase 5) (MEK 5) | EBI-25374437 | 0.35 |
| Q13164 | Mitogen-activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK-1) (Extracellular signal-regulated kinase 5) (ERK-5) | EBI-25374538 | 0.35 |
| P41240 | Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-Src kinase) (Protein-tyrosine kinase CYL) | EBI-25376544 | 0.35 |
| P46734 | Dual specificity mitogen-activated protein kinase kinase 3 (MAP kinase kinase 3) (MAPKK 3) (EC 2.7.12.2) (MAPK/ERK kinase 3) (MEK 3) (Stress-activated protein kinase kinase 2) (SAPK kinase 2) (SAPKK-2) (SAPKK2) | EBI-25377403 | 0.35 |
| P19419 | ETS domain-containing protein Elk-1 | EBI-25378580 | 0.35 |
| Q13153 | Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK) | EBI-25379067 | 0.35 |
| Q05513 | Protein kinase C zeta type (EC 2.7.11.13) (nPKC-zeta) | EBI-25380056 | 0.35 |
| P41743 | Protein kinase C iota type (EC 2.7.11.13) (Atypical protein kinase C-lambda/iota) (PRKC-lambda/iota) (aPKC-lambda/iota) (nPKC-iota) | EBI-25380638 | 0.35 |
| P30530 | Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene) | EBI-25383128 | 0.35 |
| Q13882 | Protein-tyrosine kinase 6 (EC 2.7.10.2) (Breast tumor kinase) (Tyrosine-protein kinase BRK) | EBI-25385709 | 0.35 |
| P15498 | Proto-oncogene vav | EBI-25385501 | 0.35 |
| P36507 | Dual specificity mitogen-activated protein kinase kinase 2 (MAP kinase kinase 2) (MAPKK 2) (EC 2.7.12.2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK 2) | EBI-25391779 | 0.35 |
| Q9H1R3 | Myosin light chain kinase 2, skeletal/cardiac muscle (MLCK2) (EC 2.7.11.18) | EBI-25392649 | 0.35 |
| P61586 | Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12) | EBI-25394264 | 0.35 |
| P06239 | Tyrosine-protein kinase Lck (EC 2.7.10.2) (Leukocyte C-terminal Src kinase) (LSK) (Lymphocyte cell-specific protein-tyrosine kinase) (Protein YT16) (Proto-oncogene Lck) (T cell-specific protein-tyrosine kinase) (p56-LCK) | EBI-25394571 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| P83110 | Serine protease HTRA3 (EC 3.4.21.-) (High-temperature requirement factor A3) (Pregnancy-related serine protease) | EBI-25471693 | 0.35 |
| P69479 | Phosphoprotein (Protein P) (Protein M1) | EBI-25568051 | 0.35 |
| P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | EBI-25510118 | 0.35 |
| P0DTD8 | ORF7b protein (ORF7b) (Accessory protein 7b) | EBI-25510237 | 0.35 |
| P0DTC8 | ORF8 protein (ORF8) (Non-structural protein 8) (ns8) | EBI-25510273 | 0.35 |
| Q96CS3 | FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8) | EBI-25770166 | 0.35 |
| O60260 | E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2) | EBI-25879547 | 0.56 |
| Q6PB30 | Putative chondrosarcoma-associated gene 1 protein (Cancer/testis antigen 24.1) (CT24.1) (Cancer/testis antigen CSAGE) | EBI-26354359 | 0.35 |
| Q9Y5P2 | Chondrosarcoma-associated gene 2/3 protein (Cancer/testis antigen 24.2) (CT24.2) (Taxol-resistant-associated gene 3 protein) (TRAG-3) | EBI-26354638 | 0.35 |
| P52298 | Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1) | EBI-26399642 | 0.35 |
| Q8TB24 | Ras and Rab interactor 3 (Ras interaction/interference protein 3) | EBI-26518569 | 0.35 |
| P48431 | Transcription factor SOX-2 | EBI-26574478 | 0.35 |
| O60303 | Katanin-interacting protein | EBI-26582514 | 0.35 |
| Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-26610886 | 0.35 |
| A0A0H3NJM6 | SPI-2 type III secretion system effector SopD2 (Type III secretion system effector protein) | EBI-27055978 | 0.27 |
| A0A0H3NB75 | Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV) | EBI-27055983 | 0.27 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27109494 | 0.35 |
| P22612 | cAMP-dependent protein kinase catalytic subunit gamma (PKA C-gamma) (EC 2.7.11.11) | EBI-28934688 | 0.35 |
| Q8NCK7 | Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11) | EBI-27103180 | 0.35 |
| A4FU01 | Myotubularin-related protein 11 (Cisplatin resistance-associated protein) (hCRA) (Inactive phosphatidylinositol 3-phosphatase 11) | EBI-27113520 | 0.35 |
| A6NLX3 | Speedy protein E4 | EBI-28997370 | 0.35 |
| Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.35 |
| P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | EBI-29628346 | 0.35 |
| P11362 | Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) | EBI-32718427 | 0.42 |
| P08069 | Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] | EBI-32718669 | 0.35 |
| P06213 | Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta] | EBI-32718777 | 0.35 |
| P04629 | High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA) | EBI-32719115 | 0.42 |
| Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32719212 | 0.35 |
| Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2) | EBI-32719482 | 0.35 |
| Q06418 | Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF) | EBI-32719716 | 0.35 |
| P35916 | Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4) | EBI-32722728 | 0.27 |
Database | Links |
| UNIPROT | P31689 Q5T7Q0 Q86TL9 |
| PDB | 2LO1 2M6Y 6E8M |
| Pfam | PF00226 PF01556 PF00684 |
| PROSITE | PS00636 PS50076 PS51188 |
| OMIM | 602837 |
| DisGeNET | 3301 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory