NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Proline-rich protein 7 - Rattus norvegicus - NucEnvDB

Proline-rich protein 7 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Proline-rich protein 7
Accession Code	P0C6T3
Gene	Prr7
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 269)
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVPPR PWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTDSELSSREPLEHGAWRLPVSI PLFGRTTAV

Subcellular Location

Description
Cell membrane {By SimilarityUniProtKB:Q8TB68}; Single-pass type III membrane protein {Curator Inference}. Postsynaptic cell membrane {Experimental EvidencePubMed:15629447}; Single-pass type III membrane protein {Curator Inference}. Postsynaptic density membrane {Experimental EvidencePubMed:15629447, ECO:0000269\|PubMed:27458189}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q8TB68}. Synapse {ECO:0000269\|PubMed:27458189}. Cell projection, dendrite {ECO:0000269\|PubMed:27458189}. Nucleus {ECO:0000269\|PubMed:27458189}. Note=Enriched in postsynaptic plasma membrane and postsynaptic densities (PSD) (PubMed:15629447, PubMed:27458189). Accumulates in spines along with synapse maturation and colocalizes with DLG4 in a punctate pattern (PubMed:15629447). Translocates from synapses to nuclei following NMDA receptor activity (PubMed:27458189). {Experimental EvidencePubMed:15629447, ECO:0000269\|PubMed:27458189}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Cytosol (GO:0005829) Dendrite (GO:0030425) Glutamatergic Synapse (GO:0098978) Neuron Projection (GO:0043005) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density (GO:0014069) Postsynaptic Density Membrane (GO:0098839) Postsynaptic Density, Intracellular Component (GO:0099092) Synapse (GO:0045202)

Biology & Function

Description
Acts as a synapse-to-nucleus messenger to promote NMDA receptor-mediated excitotoxicity in neurons in a JUN-dependent manner (PubMed:27458189). Inhibits ubiquitination-mediated degradation and promotes phosphorylation and transcriptional activity of transcription factor JUN (PubMed:27458189). Might play a redundant role in the regulation of T cell receptor signaling (By similarity). Might promote apoptosis in T cells (By similarity). {By SimilarityUniProtKB:Q8TB68, Experimental EvidencePubMed:27458189}.
Assigned Ontology terms

Biological Process	Adaptive Immune Response (GO:0002250) Alpha-Beta T Cell Differentiation (GO:0046632) Negative Regulation Of Protein Ubiquitination (GO:0031397) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of Cell Death (GO:0010942) Positive Regulation Of Cysteine-Type Endopeptidase Activity Involved In Apoptotic Signaling Pathway (GO:2001269) Postsynapse To Nucleus Signaling Pathway (GO:0099527) T Cell Differentiation In Thymus (GO:0033077)
Molecular Function	Long-Chain Fatty Acid Binding (GO:0036041) Protein Tyrosine Kinase Binding (GO:1990782) Protein-Containing Complex Binding (GO:0044877) Ubiquitin-Like Protein Ligase Binding (GO:0044389)

Cross-References

Database	Links
UNIPROT	P0C6T3

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK