Non-structural protein 11 - Severe acute respiratory syndrome-related coronavirus

Non-structural protein 11 (Severe acute respiratory syndrome-related coronavirus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Non-structural protein 11
Accession Code	P0C6U8
Gene	1a
Organism	Severe acute respiratory syndrome-related coronavirus (Taxonomy: 694009)
Part of Reference Proteome?	Yes
Sequence (Length: 4382)
MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTN HGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQN WNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAW FTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTL MKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKG GRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASF SASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIP DLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVE FLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQC IRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYC ALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAV VKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGL PLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAAN IHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQD ILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQK PVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSK KAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEE TRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAAR CMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVE FHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRAR AGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGV SIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV TDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQ MTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSN SFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENT SITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFT KSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYC NGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGL SAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVEC TTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHL YFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDS TEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDL EVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLT CATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIIST DDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLI EYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEY CRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYY FMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAI YVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDT TSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPR HVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRT ILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAA CAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDD AARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVY CFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMS DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQA IASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRA KVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVD ADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLA LLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPAN STVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFC DLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNGFAV

Structure Viewer (PDB: 3F9H)

Subcellular Location

Description
[Non-structural protein 2]: Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endosome {By SimilarityUniProtKB:P0DTD1}. [Papain-like protease nsp3]: Host membrane {Curator Inference}; Multi-pass membrane protein. Host cytoplasm {Experimental EvidencePubMed:23943763}. [Non-structural protein 4]: Host membrane; Multi- pass membrane protein. Host cytoplasm {Experimental EvidencePubMed:23943763}. Note=Localizes in virally-induced cytoplasmic double-membrane vesicles. {Experimental EvidencePubMed:21345958, Experimental EvidencePubMed:23943763}. [3C-like proteinase nsp5]: Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host Golgi apparatus {By SimilarityUniProtKB:P0DTD1}. [Non-structural protein 6]: Host membrane {Curator Inference}; Multi-pass membrane protein {Curator Inference}. [Non-structural protein 7]: Host cytoplasm, host perinuclear region {ECO:0000250}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. [Non-structural protein 8]: Host cytoplasm, host perinuclear region {ECO:0000269\|PubMed:17532020}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. [Non-structural protein 9]: Host cytoplasm, host perinuclear region {ECO:0000250}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. [Non-structural protein 10]: Host cytoplasm, host perinuclear region {ECO:0000250}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes.
Position in the Nuclear Envelope
Location	Location ID	Description
Host Perinuclear Region	SL-0382	The host perinuclear region is the host cytoplasmic region just around the host nucleus. Note: This location is defined for viral proteins that appear in the perinuclear region of infected host cells
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Curator Inference {ECO:0000305\|PubMed:18842706}
Assigned Ontology terms

Cellular Component	Cytoplasmic Viral Factory (GO:0039714) Double Membrane Vesicle Viral Factory Outer Membrane (GO:0062243) Host Cell Cytoplasm (GO:0030430) Host Cell Endoplasmic Reticulum (GO:0044165) Host Cell Endosome (GO:0044174) Host Cell Golgi Apparatus (GO:0044177) Host Cell Perinuclear Region Of Cytoplasm (GO:0044220)

Biology & Function

Description
[Isoform Replicase polyprotein 1a]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {Curator Inference}. [Host translation inhibitor nsp1]: Inhibits host translation by interacting with the 40S ribosomal subunit. The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation. Viral mRNAs are not susceptible to nsp1-mediated endonucleolytic RNA cleavage thanks to the presence of a 5'-end leader sequence and are therefore protected from degradation. By suppressing host gene expression, nsp1 facilitates efficient viral gene expression in infected cells and evasion from host immune response (PubMed:23035226). May disrupt nuclear pore function by binding and displacing host NUP93 (PubMed:30943371). {Experimental EvidencePubMed:23035226, Experimental EvidencePubMed:30943371}. [Non-structural protein 2]: May play a role in the modulation of host cell survival signaling pathway by interacting with host PHB and PHB2 (PubMed:19640993). Indeed, these two proteins play a role in maintaining the functional integrity of the mitochondria and protecting cells from various stresses (PubMed:19640993). {Experimental EvidencePubMed:19640993}. [Papain-like protease nsp3]: Responsible for the cleavages located at the N-terminus of the replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed:17692280). Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:24410069, PubMed:23943763). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed:19369340, PubMed:24622840). Prevents also host NF-kappa-B signaling (PubMed:19369340, PubMed:24622840). {Experimental EvidencePubMed:16271890, Experimental EvidencePubMed:17692280, Experimental EvidencePubMed:19369340, Experimental EvidencePubMed:23943763, Experimental EvidencePubMed:24622840, Curator InferencePubMed:24410069}. [Non-structural protein 4]: Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763, PubMed:24410069). Alone appears incapable to induce membrane curvature, but together with nsp3 is able to induce paired membranes (PubMed:23943763). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:23943763, PubMed:24410069). {Experimental EvidencePubMed:23943763, Curator InferencePubMed:24410069}. [3C-like proteinase nsp5]: Cleaves the C-terminus of replicase polyprotein at 11 sites. Recognizes substrates containing the core sequence [ILMVF]-Q-\|-[SGACN]. Also able to bind an ADP-ribose-1''- phosphate (ADRP). May cleave host ATP6V1G1 thereby modifying host vacuoles intracellular pH. {Sequence AnalysisPROSITE-ProRule:PRU00772, Experimental EvidencePubMed:16226257}. [Non-structural protein 6]: Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:23943763, PubMed:24410069). Plays a role in the initial induction of autophagosomes from host reticulum endoplasmic. Later, limits the expansion of these phagosomes that are no longer able to deliver viral components to lysosomes (PubMed:24991833). {Experimental EvidencePubMed:23943763, Experimental EvidencePubMed:24991833, Curator InferencePubMed:24410069}. [Non-structural protein 7]: Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers. {ECO:0000269\|PubMed:22039154}. [Non-structural protein 8]: Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers. {ECO:0000269\|PubMed:22039154}. [Non-structural protein 9]: Plays an essential role in viral replication by forming a homodimer that binds single-stranded RNA. {ECO:0000269\|PubMed:19153232}. [Non-structural protein 10]: Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease and nsp16 2'-O-methyltransferase activities. Therefore plays an essential role in viral mRNAs cap methylation. {ECO:0000269\|PubMed:22635272}.
Assigned Ontology terms

Biological Process	Induction By Virus Of Catabolism Of Host MRNA (GO:0039595) Induction By Virus Of Host Autophagy (GO:0039520) Modulation By Virus Of Host Autophagy (GO:0039519) Modulation By Virus Of Host Protein Ubiquitination (GO:0039648) Positive Stranded Viral RNA Replication (GO:0039690) Protein Autoprocessing (GO:0016540) Protein K48-Linked Deubiquitination (GO:0071108) Protein K63-Linked Deubiquitination (GO:0070536) Proteolysis (GO:0006508) Suppression By Virus Of Host Gene Expression (GO:0039657) Suppression By Virus Of Host ISG15-Protein Conjugation (GO:0039579) Suppression By Virus Of Host NF-KappaB Cascade (GO:0039644) Suppression By Virus Of Host Toll-Like Receptor Signaling Pathway (GO:0039722) Suppression By Virus Of Host Translation (GO:0039604) Suppression By Virus Of Host Type I Interferon Production (GO:0039501) Suppression By Virus Of Host Type I Interferon-Mediated Signaling Pathway (GO:0039502) Suppression By Virus Of Host Viral-Induced Cytoplasmic Pattern Recognition Receptor Signaling Pathway Via Inhibition Of IRF3 Activity (GO:0039548) Viral Genome Replication (GO:0019079) Viral Protein Processing (GO:0019082) Viral RNA Genome Replication (GO:0039694) Viral Transcription (GO:0019083)
Molecular Function	Cysteine-Type Deubiquitinase Activity (GO:0004843) Cysteine-Type Endopeptidase Activity (GO:0004197) Double-Stranded RNA Binding (GO:0003725) Endonuclease Activity (GO:0004519) G-Quadruplex RNA Binding (GO:0002151) Identical Protein Binding (GO:0042802) ISG15-Specific Peptidase Activity (GO:0019785) Lyase Activity (GO:0016829) Omega Peptidase Activity (GO:0008242) Protein Dimerization Activity (GO:0046983) RNA-Dependent RNA Polymerase Activity (GO:0003968) Single-Stranded RNA Binding (GO:0003727) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P0C6U8	Self	EBI-25610728	0.72
P0C6X7	2'-O-methyltransferase nsp16	EBI-25492630	0.51
Interactions with other proteins (20 interactors)

Partner (UniProt)		IntAct	Confidence score
P62753	40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6)	EBI-15811015	0.40
P59637	Envelope small membrane protein (E protein) (sM protein)	EBI-25492828	0.37
Q53GL7	Protein mono-ADP-ribosyltransferase PARP10 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 10) (ARTD10) (Poly [ADP-ribose] polymerase 10) (PARP-10)	EBI-25619173	0.44
L5LC70	Ubiquitin-like protein ISG15	EBI-25760958	0.62
P05161	Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein) (hUCRP)	EBI-25760974	0.72
P62992	Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a]	EBI-25775419	0.56
R9QB93	ISG15	EBI-25821194	0.44
Q64339	Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein)	EBI-25821352	0.62
A0A5N4DAX7	Ubiquitin-like protein ISG15	EBI-25821415	0.44
Q9GKP4		EBI-25821587	0.56
Q9C0D3	Protein zyg-11 homolog B	EBI-26376963	0.35
Q92624	Amyloid protein-binding protein 2 (Amyloid beta precursor protein-binding protein 2) (APP-BP2) (Protein interacting with APP tail 1)	EBI-26376963	0.35
Q9H074	Polyadenylate-binding protein-interacting protein 1 (PABP-interacting protein 1) (PAIP-1) (Poly(A)-binding protein-interacting protein 1)	EBI-26970949	0.68
P11940	Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1)	EBI-26971142	0.50
P15311	Ezrin (Cytovillin) (Villin-2) (p81)	EBI-30809805	0.40
Q8IZU9	Kin of IRRE-like protein 3 (Kin of irregular chiasm-like protein 3) (Nephrin-like protein 2) [Cleaved into: Processed kin of IRRE-like protein 3]	EBI-30809847	0.40
Q13283	Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1)	EBI-30810106	0.40
Q9UN86	Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2)	EBI-30810451	0.40
Q9BXW4	Microtubule-associated proteins 1A/1B light chain 3C (Autophagy-related protein LC3 C) (Autophagy-related ubiquitin-like modifier LC3 C) (MAP1 light chain 3-like protein 3) (MAP1A/MAP1B light chain 3 C) (MAP1A/MAP1B LC3 C) (Microtubule-associated protein 1 light chain 3 gamma)	EBI-30810678	0.40
Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	EBI-30810755	0.40

Cross-References

Database	Links
UNIPROT	P0C6U8 P59641
PDB	1Q2W 1QZ8 1UJ1 1UK2 1UK3 1UK4 1UW7 1WOF 1YSY 1Z1I 1Z1J 2A5A 2A5I 2A5K 2ACF 2AHM 2ALV 2AMD 2AMQ 2BX3 2BX4 2C3S 2D2D 2DUC 2FAV 2FE8 2FYG 2G9T 2GA6 2GDT 2GRI 2GT7 2GT8 2GTB 2GX4 2GZ7 2GZ8 2GZ9 2H2Z 2HOB 2HSX 2IDY 2KAF 2KQV 2KQW 2KYS 2LIZ 2OP9 2PWX 2W2G 2WCT 2Z3C 2Z3D 2Z3E 2ZU4 2ZU5 3ATW 3AVZ 3AW0 3AW1 3E91 3EA7 3EA8 3EA9 3EAJ 3EE7 3F9E 3F9F 3F9G 3F9H 3FZD 3IWM 3M3S 3M3T 3M3V 3MJ5 3R24 3SN8 3SNA 3SNB 3SNC 3SND 3SNE 3SZN 3TIT 3TIU 3TNS 3TNT 3V3M 3VB3 3VB4 3VB5 3VB6 3VB7 4HI3 4M0W 4MDS 4MM3 4OVZ 4OW0 5F22 5Y3E 5Y3Q 6LNY 6LO0 6NUR 6NUS 6W2A 6XHL 6XHN 6XHO 6Y7M 6YXJ 7DQZ 7EO8 7K0G 7K0H 7LFU 7LFV 7LMG 7LMH 7LMI 7LMJ 7OPL 7RC1 7VLO
Pfam	PF16251 PF11501 PF12379 PF12124 PF11633 PF09401 PF19212 PF19211 PF19218 PF16348 PF19217 PF19213 PF08716 PF08717 PF08710 PF08715 PF01661 PF05409
PROSITE	PS51963 PS51942 PS51941 PS51994 PS51945 PS51952 PS51962 PS51991 PS51990 PS51989 PS51992 PS51943 PS51944 PS51946 PS51949 PS51950 PS51951 PS51442 PS51154 PS51124 PS51940

Non-structural protein 11 (Severe acute respiratory syndrome-related coronavirus)

General Information

Protein Information

Structure Viewer (PDB: 3F9H)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Interactions with other proteins (20 interactors)

Cross-References

Database

Links

Description

Description