Protein Information |
|
|---|---|
| Protein Name | 2'-O-methyltransferase nsp16 |
| Accession Code | P0C6X7 |
| Gene | rep |
| Organism | Severe acute respiratory syndrome-related coronavirus (Taxonomy: 694009) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 7073) | |
|
MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTN HGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQN WNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAW FTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTL MKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKG GRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASF SASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIP DLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVE FLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQC IRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYC ALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAV VKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGL PLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAAN IHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQD ILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQK PVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSK KAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEE TRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAAR CMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVE FHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPS DDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRAR AGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGV SIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV TDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQ MTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSN SFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENT SITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFT KSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYC NGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGL SAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVEC TTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHL YFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDS TEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDL EVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLT CATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIIST DDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLI EYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEY CRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYY FMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAI YVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDT TSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPR HVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRT ILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAA CAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDD AARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVY CFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMS DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQA IASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRA KVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVD ADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLA LLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPAN STVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFC DLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNRVCGVSAARLTPCGTGTSTDVV YRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMV PHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQ FCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRALAAESHMDADLAKPLIKWDLL KYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFREL GVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKE GSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGK ARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGT SKFYGGWHNMLKTVYSDVETPHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGG SLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDHEFVDEFYAYLRK HFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPY PDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDN TSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTD VTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLK ATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKL NVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYY PSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMA TNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDN KLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGS EYDYVIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKIITGL HPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR DAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLS DRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHD QHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAI KCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGS LYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAY NMMISAGFSLWIYKQFDTYNLWNTFTRLQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPV NVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQV DLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMET DFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCV CSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQASQAWQPGVAMPNLYKMQRMLLEKC DLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVS DADSTLIGDCATVHTANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMG HFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEN QINDMIYSLLEKGRLIIRENNRVVVSSDILVNN |
|
Structure Viewer (PDB: 5C8U) |
|---|
Description |
||
|---|---|---|
| [Non-structural protein 2]: Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endosome {By SimilarityUniProtKB:P0DTD1}. [Papain-like protease nsp3]: Host membrane {Curator Inference}; Multi-pass membrane protein. Host cytoplasm {Experimental EvidencePubMed:23943763}. [Non-structural protein 4]: Host membrane; Multi- pass membrane protein. Host cytoplasm {Experimental EvidencePubMed:23943763}. Note=Localizes in virally-induced cytoplasmic double-membrane vesicles. {Experimental EvidencePubMed:17855519, Experimental EvidencePubMed:21345958, Experimental EvidencePubMed:23943763}. [3C-like proteinase nsp5]: Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host Golgi apparatus {By SimilarityUniProtKB:P0DTD1}. [Non-structural protein 6]: Host membrane {Curator Inference}; Multi-pass membrane protein {Curator Inference}. [Non-structural protein 7]: Host cytoplasm, host perinuclear region {ECO:0000250}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. [Non-structural protein 8]: Host cytoplasm, host perinuclear region {ECO:0000269|PubMed:17532020}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. [Non-structural protein 9]: Host cytoplasm, host perinuclear region {ECO:0000250}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. [Non-structural protein 10]: Host cytoplasm, host perinuclear region {ECO:0000250}. Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. Note=nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes. [Helicase nsp13]: Host endoplasmic reticulum- Golgi intermediate compartment {Curator Inference}. Note=The helicase interacts with the N protein in membranous complexes and colocalizes with sites of synthesis of new viral RNA. [Proofreading exoribonuclease nsp14]: Host cytoplasm {By SimilarityUniProtKB:P0DTD1}. Host endoplasmic reticulum {By SimilarityUniProtKB:P0DTD1}. [Uridylate-specific endoribonuclease nsp15]: Host cytoplasm, host perinuclear region {ECO:0000250}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Host Perinuclear Region | SL-0382 | The host perinuclear region is the host cytoplasmic region just around the host nucleus. Note: This location is defined for viral proteins that appear in the perinuclear region of infected host cells | Membrane Topology |
| Topology | Source | Annotation Type |
| Transmembrane | UniProt | Curator Inference {ECO:0000305|PubMed:18842706} | Assigned Ontology terms |
| Cellular Component | Cytoplasmic Viral Factory (GO:0039714) Double Membrane Vesicle Viral Factory Outer Membrane (GO:0062243) Endopeptidase Complex (GO:1905369) Endoribonuclease Complex (GO:1902555) Exoribonuclease Complex (GO:1905354) Host Cell Cytoplasm (GO:0030430) Host Cell Endoplasmic Reticulum (GO:0044165) Host Cell Endoplasmic Reticulum-Golgi Intermediate Compartment (GO:0044172) Host Cell Endosome (GO:0044174) Host Cell Golgi Apparatus (GO:0044177) Host Cell Perinuclear Region Of Cytoplasm (GO:0044220) Obsolete Integral To Membrane Of Host Cell (GO:0044385) MRNA Cap Methyltransferase Complex (GO:0031533) Viral RNA-Directed RNA Polymerase Complex (GO:0031381) |
|
Description |
|
|---|---|
| [Isoform Replicase polyprotein 1ab]: Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein. {Curator Inference}. [Host translation inhibitor nsp1]: Inhibits host translation by interacting with the 40S ribosomal subunit. The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation. Viral mRNAs are not susceptible to nsp1-mediated endonucleolytic RNA cleavage thanks to the presence of a 5'-end leader sequence and are therefore protected from degradation. By suppressing host gene expression, nsp1 facilitates efficient viral gene expression in infected cells and evasion from host immune response (PubMed:23035226). May disrupt nuclear pore function by binding and displacing host NUP93 (PubMed:30943371). {Experimental EvidencePubMed:23035226, Experimental EvidencePubMed:30943371}. [Non-structural protein 2]: May play a role in the modulation of host cell survival signaling pathway by interacting with host PHB and PHB2 (PubMed:19640993). Indeed, these two proteins play a role in maintaining the functional integrity of the mitochondria and protecting cells from various stresses (PubMed:19640993). {Experimental EvidencePubMed:19640993}. [Papain-like protease nsp3]: Responsible for the cleavages located at the N-terminus of the replicase polyprotein (PubMed:16306590). In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed:16306590, PubMed:17692280). Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:24410069). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed:19369340, PubMed:24622840). Prevents also host NF- kappa-B signaling (PubMed:19369340, PubMed:24622840). {Experimental EvidencePubMed:16306590, Experimental EvidencePubMed:17692280, Experimental EvidencePubMed:19369340, Experimental EvidencePubMed:23943763, Experimental EvidencePubMed:24622840, Curator InferencePubMed:24410069}. [Non-structural protein 4]: Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:23943763). Alone appears incapable to induce membrane curvature, but together with nsp3 is able to induce paired membranes. Nsp3, nsp4 and nsp6 together are sufficient to form DMV. {Experimental EvidencePubMed:23943763, Curator InferencePubMed:24410069}. [3C-like proteinase nsp5]: Cleaves the C-terminus of replicase polyprotein at 11 sites. Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN]. Also able to bind an ADP-ribose-1''- phosphate (ADRP). May cleave host ATP6V1G1 thereby modifying host vacuoles intracellular pH. {Sequence AnalysisPROSITE-ProRule:PRU00772, Experimental EvidencePubMed:16226257}. [Non-structural protein 6]: Plays a role in host membrane rearrangement that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication (PubMed:24991833, PubMed:24410069). Nsp3, nsp4 and nsp6 together are sufficient to form DMV (PubMed:24991833, PubMed:24410069). Plays a role in the initial induction of autophagosomes from host reticulum endoplasmic. Later, limits the expansion of these phagosomes that are no longer able to deliver viral components to lysosomes (PubMed:24991833). {Experimental EvidencePubMed:24991833, Curator InferencePubMed:24410069}. [Non-structural protein 7]: Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers. {Experimental EvidencePubMed:22039154}. [Non-structural protein 8]: Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers. {Experimental EvidencePubMed:22039154}. [Non-structural protein 9]: Plays an essential role in viral replication by forming a homodimer that binds single-stranded RNA. {Experimental EvidencePubMed:19153232}. [Non-structural protein 10]: Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease and nsp16 2'-O-methyltransferase activities. Therefore plays an essential role in viral mRNAs cap methylation. {Experimental EvidencePubMed:22022266, Experimental EvidencePubMed:22635272}. [RNA-directed RNA polymerase nsp12]: Responsible for replication and transcription of the viral RNA genome. {Experimental EvidencePubMed:22791111}. [Helicase nsp13]: Multi-functional protein with a zinc- binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium. {Experimental EvidencePubMed:12917423, Experimental EvidencePubMed:22615777}. [Proofreading exoribonuclease nsp14]: Enzyme possessing two different activities: an exoribonuclease activity acting on both ssRNA and dsRNA in a 3' to 5' direction and a N7-guanine methyltransferase activity (PubMed:16549795, PubMed:20421945, PubMed:22635272). Acts as a proofreading exoribonuclease for RNA replication, thereby lowering The sensitivity of the virus to RNA mutagens (PubMed:23966862, PubMed:29511076, PubMed:21593585). {Experimental EvidencePubMed:16549795, Experimental EvidencePubMed:20421945, Experimental EvidencePubMed:21593585, Experimental EvidencePubMed:22635272, Experimental EvidencePubMed:23966862, ECO:0000269|PubMed:29511076}. [Uridylate-specific endoribonuclease nsp15]: Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR (PubMed:28158275, PubMed:18045871). Acts by degrading the 5'- polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs. Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P) (PubMed:16828802). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors (PubMed:28158275, PubMed:18045871). {ECO:0000269|PubMed:16828802, ECO:0000269|PubMed:18045871, ECO:0000269|PubMed:28158275}. [2'-O-methyltransferase nsp16]: Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs (PubMed:18417574, PubMed:22022266, PubMed:20421945). N7- methyl guanosine cap is a prerequisite for binding of nsp16 (PubMed:18417574). Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system (PubMed:18417574, PubMed:22022266, PubMed:20421945). {ECO:0000269|PubMed:18417574, Experimental EvidencePubMed:20421945, Experimental EvidencePubMed:22022266, Curator Inference}. | Assigned Ontology terms |
| Biological Process | 7-Methylguanosine MRNA Capping (GO:0006370) DNA-Templated Transcription (GO:0006351) Induction By Virus Of Catabolism Of Host MRNA (GO:0039595) Induction By Virus Of Host Autophagy (GO:0039520) Modulation By Virus Of Host Protein Ubiquitination (GO:0039648) MRNA Methylation (GO:0080009) Positive Regulation Of RNA Biosynthetic Process (GO:1902680) Positive Regulation Of Ubiquitin-Specific Protease Activity (GO:2000158) Positive Regulation Of Viral Genome Replication (GO:0045070) Positive Stranded Viral RNA Replication (GO:0039690) Protein Autoprocessing (GO:0016540) Protein K48-Linked Deubiquitination (GO:0071108) Protein K63-Linked Deubiquitination (GO:0070536) Protein Processing (GO:0016485) Proteolysis (GO:0006508) RNA Phosphodiester Bond Hydrolysis, Exonucleolytic (GO:0090503) RNA-Templated Transcription (GO:0001172) Suppression By Virus Of Host Gene Expression (GO:0039657) Suppression By Virus Of Host ISG15-Protein Conjugation (GO:0039579) Suppression By Virus Of Host NF-KappaB Cascade (GO:0039644) Suppression By Virus Of Host Toll-Like Receptor Signaling Pathway (GO:0039722) Suppression By Virus Of Host Translation (GO:0039604) Suppression By Virus Of Host Type I Interferon Production (GO:0039501) Suppression By Virus Of Host Type I Interferon-Mediated Signaling Pathway (GO:0039502) Suppression By Virus Of Host Viral-Induced Cytoplasmic Pattern Recognition Receptor Signaling Pathway Via Inhibition Of IRF3 Activity (GO:0039548) Viral Protein Processing (GO:0019082) Viral Replication Complex Formation And Maintenance (GO:0046786) Viral RNA Genome Replication (GO:0039694) Viral Transcription (GO:0019083) |
| Molecular Function | 3'-5'-Exoribonuclease Activity (GO:0000175) 5'-3' RNA Helicase Activity (GO:0032574) ATP Binding (GO:0005524) ATP Hydrolysis Activity (GO:0016887) Cysteine-Type Deubiquitinase Activity (GO:0004843) Cysteine-Type Endopeptidase Activity (GO:0004197) DNA Helicase Activity (GO:0003678) Double-Stranded RNA Binding (GO:0003725) Endonuclease Activity (GO:0004519) G-Quadruplex RNA Binding (GO:0002151) Helicase Activity (GO:0004386) Identical Protein Binding (GO:0042802) ISG15-Specific Peptidase Activity (GO:0019785) Lyase Activity (GO:0016829) K48-Linked Deubiquitinase Activity (GO:1990380) MRNA (Guanine-N7-)-Methyltransferase Activity (GO:0004482) MRNA (Nucleoside-2'-O-)-Methyltransferase Activity (GO:0004483) Omega Peptidase Activity (GO:0008242) Protein Dimerization Activity (GO:0046983) RNA-Dependent RNA Polymerase Activity (GO:0003968) Single-Stranded RNA Binding (GO:0003727) Zinc Ion Binding (GO:0008270) |
Interactions with Nuclear Envelope proteins (23 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| K9N638 | Non-structural protein 11 | EBI-26366798 | 0.44 |
| P0C6U8 | Non-structural protein 11 | EBI-25492630 | 0.51 |
| P0C6X7 | Self | EBI-25490398 | 0.89 |
| Q5SQN1 | Synaptosomal-associated protein 47 | EBI-25488935 | 0.51 |
| Q8TEB7 | E3 ubiquitin-protein ligase RNF128 | EBI-25488783 | 0.37 |
| P49903 | Selenide, water dikinase 1 | EBI-25688150 | 0.35 |
| Q86WV6 | Stimulator of interferon genes protein | EBI-25751009 | 0.40 |
| Q99720 | Sigma non-opioid intracellular receptor 1 | EBI-26377180 | 0.40 |
| O15182 | Centrin-3 | EBI-26376977 | 0.35 |
| Q9BV73 | Centrosome-associated protein CEP250 | EBI-26377017 | 0.35 |
| Q8IY37 | Probable ATP-dependent RNA helicase DHX37 | EBI-26377216 | 0.35 |
| Q96KC8 | DnaJ homolog subfamily C member 1 | EBI-26377188 | 0.35 |
| O75821 | Eukaryotic translation initiation factor 3 subunit G | EBI-26377128 | 0.35 |
| P62879 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | EBI-25507431 | 0.37 |
| Q9UM54 | Unconventional myosin-VI | EBI-26377017 | 0.35 |
| Q9H7Z7 | Prostaglandin E synthase 2 truncated form | EBI-26377188 | 0.35 |
| Q8TEM1 | Nuclear pore membrane glycoprotein 210 | EBI-26377113 | 0.35 |
| Q6ZRP7 | Sulfhydryl oxidase 2 | EBI-26377188 | 0.35 |
| P0C6Y0 | 2'-O-methyl transferase | EBI-25758199 | 0.44 |
| P0C6Y5 | Putative 2'-O-methyl transferase | EBI-25758300 | 0.44 |
| Q98VG9 | Putative 2'-O-methyl transferase | EBI-25758361 | 0.44 |
| P0C6Y1 | 2'-O-methyl transferase | EBI-25758560 | 0.44 |
| K9N7C7 | 2'-O-methyltransferase | EBI-25758227 | 0.44 | Interactions with other proteins (346 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| O75348 | V-type proton ATPase subunit G 1 (V-ATPase subunit G 1) (V-ATPase 13 kDa subunit 1) (Vacuolar proton pump subunit G 1) (Vacuolar proton pump subunit M16) | EBI-7843859 | 0.66 |
| P62937 | Peptidyl-prolyl cis-trans isomerase A (PPIase A) (EC 5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed] | EBI-25488476 | 0.51 |
| Q9UQN3 | Charged multivesicular body protein 2b (CHMP2.5) (Chromatin-modifying protein 2b) (CHMP2b) (Vacuolar protein sorting-associated protein 2-2) (Vps2-2) (hVps2-2) | EBI-25488518 | 0.51 |
| Q9Y4W2 | Ribosomal biogenesis protein LAS1L (Protein LAS1 homolog) | EBI-25488511 | 0.51 |
| Q9UKA8 | Calcipressin-3 (Down syndrome candidate region 1-like protein 2) (Myocyte-enriched calcineurin-interacting protein 3) (MCIP3) (Regulator of calcineurin 3) | EBI-25488504 | 0.51 |
| O43447 | Peptidyl-prolyl cis-trans isomerase H (PPIase H) (EC 5.2.1.8) (Rotamase H) (Small nuclear ribonucleoprotein particle-specific cyclophilin H) (CypH) (U-snRNP-associated cyclophilin SnuCyp-20) (USA-CYP) | EBI-25488497 | 0.51 |
| Q13427 | Peptidyl-prolyl cis-trans isomerase G (PPIase G) (Peptidyl-prolyl isomerase G) (EC 5.2.1.8) (CASP10) (Clk-associating RS-cyclophilin) (CARS-Cyp) (CARS-cyclophilin) (SR-cyclophilin) (SR-cyp) (SRcyp) (Cyclophilin G) (Rotamase G) | EBI-25488490 | 0.51 |
| P62942 | Peptidyl-prolyl cis-trans isomerase FKBP1A (PPIase FKBP1A) (EC 5.2.1.8) (12 kDa FK506-binding protein) (12 kDa FKBP) (FKBP-12) (Calstabin-1) (FK506-binding protein 1A) (FKBP-1A) (Immunophilin FKBP12) (Rotamase) | EBI-25488483 | 0.51 |
| O95299 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (Complex I-42kD) (CI-42kD) (NADH-ubiquinone oxidoreductase 42 kDa subunit) | EBI-25489287 | 0.40 |
| Q8TD31 | Coiled-coil alpha-helical rod protein 1 (Alpha-helical coiled-coil rod protein) (Putative gene 8 protein) (Pg8) | EBI-25488553 | 0.55 |
| P20231 | Tryptase beta-2 (Tryptase-2) (EC 3.4.21.59) (Tryptase II) | EBI-25488546 | 0.37 |
| P30876 | DNA-directed RNA polymerase II subunit RPB2 (EC 2.7.7.6) (DNA-directed RNA polymerase II 140 kDa polypeptide) (DNA-directed RNA polymerase II subunit B) (RNA polymerase II subunit 2) (RNA polymerase II subunit B2) | EBI-25488539 | 0.37 |
| Q15661 | Tryptase alpha/beta-1 (Tryptase-1) (EC 3.4.21.59) (Tryptase I) (Tryptase alpha-1) | EBI-25489276 | 0.40 |
| Q99471 | Prefoldin subunit 5 (Myc modulator 1) (c-Myc-binding protein Mm-1) | EBI-25489298 | 0.40 |
| Q99426 | Tubulin-folding cofactor B (Cytoskeleton-associated protein 1) (Cytoskeleton-associated protein CKAPI) (Tubulin-specific chaperone B) | EBI-25488574 | 0.37 |
| P51948 | CDK-activating kinase assembly factor MAT1 (CDK7/cyclin-H assembly factor) (Cyclin-G1-interacting protein) (Menage a trois) (RING finger protein 66) (RING finger protein MAT1) (p35) (p36) | EBI-25488581 | 0.37 |
| Q13064 | Probable E3 ubiquitin-protein ligase makorin-3 (EC 2.3.2.27) (RING finger protein 63) (RING-type E3 ubiquitin transferase makorin-3) (Zinc finger protein 127) | EBI-25488700 | 0.51 |
| P09630 | Homeobox protein Hox-C6 (Homeobox protein CP25) (Homeobox protein HHO.C8) (Homeobox protein Hox-3C) | EBI-25488588 | 0.37 |
| Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-25488595 | 0.51 |
| P27448 | MAP/microtubule affinity-regulating kinase 3 (EC 2.7.11.1) (C-TAK1) (cTAK1) (Cdc25C-associated protein kinase 1) (ELKL motif kinase 2) (EMK-2) (Protein kinase STK10) (Ser/Thr protein kinase PAR-1) (Par-1a) (Serine/threonine-protein kinase p78) | EBI-25488602 | 0.37 |
| Q7KZI7 | Serine/threonine-protein kinase MARK2 (EC 2.7.11.1) (EC 2.7.11.26) (ELKL motif kinase 1) (EMK-1) (MAP/microtubule affinity-regulating kinase 2) (PAR1 homolog) (PAR1 homolog b) (Par-1b) (Par1b) | EBI-25488609 | 0.37 |
| O96017 | Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2) | EBI-25488616 | 0.51 |
| P05155 | Plasma protease C1 inhibitor (C1 Inh) (C1Inh) (C1 esterase inhibitor) (C1-inhibiting factor) (Serpin G1) | EBI-25488644 | 0.51 |
| Q56VL3 | OCIA domain-containing protein 2 (Ovarian carcinoma immunoreactive antigen-like protein) | EBI-25488630 | 0.37 |
| Q92802 | NEDD4-binding protein 2-like 2 (Phosphonoformate immuno-associated protein 5) | EBI-25488637 | 0.37 |
| Q13561 | Dynactin subunit 2 (50 kDa dynein-associated polypeptide) (Dynactin complex 50 kDa subunit) (DCTN-50) (p50 dynamitin) | EBI-25488651 | 0.37 |
| Q8WXF8 | DNA-binding death effector domain-containing protein 2 (DED-containing protein FLAME-3) (FADD-like anti-apoptotic molecule 3) | EBI-25488665 | 0.37 |
| Q9H000 | E3 ubiquitin-protein ligase makorin-2 (EC 2.3.2.27) (RING finger protein 62) (RING-type E3 ubiquitin transferase makorin-2) | EBI-25488693 | 0.51 |
| Q7Z3Q1 | Solute carrier family 46 member 3 | EBI-25488686 | 0.37 |
| Q7Z494 | Nephrocystin-3 | EBI-25488679 | 0.37 |
| Q13564 | NEDD8-activating enzyme E1 regulatory subunit (Amyloid beta precursor protein-binding protein 1, 59 kDa) (APP-BP1) (Amyloid protein-binding protein 1) (Proto-oncogene protein 1) | EBI-25488825 | 0.37 |
| A9UHW6 | MIF4G domain-containing protein (SLBP-interacting protein 1) (hSLIP1) | EBI-25488818 | 0.51 |
| P62258 | 14-3-3 protein epsilon (14-3-3E) | EBI-25488811 | 0.37 |
| Q9HCD5 | Nuclear receptor coactivator 5 (NCoA-5) (Coactivator independent of AF-2) (CIA) | EBI-25488804 | 0.37 |
| P49703 | ADP-ribosylation factor-like protein 4D (ADP-ribosylation factor-like protein 4L) | EBI-25488797 | 0.37 |
| Q92560 | Ubiquitin carboxyl-terminal hydrolase BAP1 (EC 3.4.19.12) (BRCA1-associated protein 1) (Cerebral protein 6) | EBI-25488790 | 0.37 |
| O95865 | N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 (DDAH-2) (Dimethylarginine dimethylaminohydrolase 2) (EC 3.5.3.18) (DDAHII) (Dimethylargininase-2) (Protein G6a) (S-phase protein) | EBI-25488776 | 0.51 |
| O14498 | Immunoglobulin superfamily containing leucine-rich repeat protein | EBI-25488769 | 0.37 |
| Q9GZN8 | UPF0687 protein C20orf27 | EBI-25488762 | 0.37 |
| P23025 | DNA repair protein complementing XP-A cells (Xeroderma pigmentosum group A-complementing protein) | EBI-25488755 | 0.37 |
| P08949 | Neuromedin-B [Cleaved into: Neuromedin-B-32; Neuromedin-B] | EBI-25488727 | 0.37 |
| Q96GS6 | Alpha/beta hydrolase domain-containing protein 17A (Abhydrolase domain-containing protein 17A) (EC 3.1.2.22) | EBI-25489377 | 0.40 |
| Q86VK4 | Zinc finger protein 410 (Another partner for ARF 1) | EBI-25488707 | 0.37 |
| Q53GL0 | Pleckstrin homology domain-containing family O member 1 (PH domain-containing family O member 1) (C-Jun-binding protein) (JBP) (Casein kinase 2-interacting protein 1) (CK2-interacting protein 1) (CKIP-1) (Osteoclast maturation-associated gene 120 protein) | EBI-25488844 | 0.37 |
| P13796 | Plastin-2 (L-plastin) (LC64P) (Lymphocyte cytosolic protein 1) (LCP-1) | EBI-25488851 | 0.37 |
| Q6P587 | Acylpyruvase FAHD1, mitochondrial (EC 3.7.1.5) (Fumarylacetoacetate hydrolase domain-containing protein 1) (FAH domain-containing protein 1) (Oxaloacetate decarboxylase) (OAA decarboxylase) (EC 4.1.1.112) (YisK-like protein) | EBI-25488921 | 0.37 |
| P23588 | Eukaryotic translation initiation factor 4B (eIF-4B) | EBI-25488893 | 0.37 |
| P54274 | Telomeric repeat-binding factor 1 (NIMA-interacting protein 2) (TTAGGG repeat-binding factor 1) (Telomeric protein Pin2/TRF1) | EBI-25488879 | 0.51 |
| Q9P0M6 | Core histone macro-H2A.2 (Histone macroH2A2) (mH2A2) | EBI-25488872 | 0.51 |
| Q9Y6E2 | eIF5-mimic protein 1 (Basic leucine zipper and W2 domain-containing protein 2) | EBI-25488865 | 0.37 |
| P69849 | Nodal modulator 3 (pM5 protein 3) | EBI-25488858 | 0.51 |
| Q9BUV0 | Arginine/serine-rich protein 1 | EBI-25488907 | 0.37 |
| P06733 | Alpha-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (C-myc promoter-binding protein) (Enolase 1) (MBP-1) (MPB-1) (Non-neural enolase) (NNE) (Phosphopyruvate hydratase) (Plasminogen-binding protein) | EBI-25488928 | 0.37 |
| P23284 | Peptidyl-prolyl cis-trans isomerase B (PPIase B) (EC 5.2.1.8) (CYP-S1) (Cyclophilin B) (Rotamase B) (S-cyclophilin) (SCYLP) | EBI-25475813 | 0.40 |
| P20290 | Transcription factor BTF3 (Nascent polypeptide-associated complex subunit beta) (NAC-beta) (RNA polymerase B transcription factor 3) | EBI-25487623 | 0.37 |
| P03901 | NADH-ubiquinone oxidoreductase chain 4L (EC 7.1.1.2) (NADH dehydrogenase subunit 4L) | EBI-25487628 | 0.37 |
| P00403 | Cytochrome c oxidase subunit 2 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) | EBI-25487633 | 0.37 |
| Q9Y2D1 | Cyclic AMP-dependent transcription factor ATF-5 (cAMP-dependent transcription factor ATF-5) (Activating transcription factor 5) (Transcription factor ATFx) | EBI-25487647 | 0.37 |
| P59632 | ORF3a protein (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | EBI-25492642 | 0.51 |
| P59636 | ORF9b protein (Accessory protein 9b) (ORF-9b) (Protein 9b) | EBI-25492804 | 0.51 |
| Q7TFA0 | ORF8a protein (Accessory protein 8a) (Protein non-structural 8a) (ns8a) | EBI-25492912 | 0.37 |
| P59637 | Envelope small membrane protein (E protein) (sM protein) | EBI-25635717 | 0.54 |
| Q80H93 | ORF8b protein (Accessory protein 8b) (Non-structural protein 8b) (ns8b) | EBI-25492945 | 0.37 |
| Q7TLC7 | Uncharacterized protein 14 | EBI-25493011 | 0.37 |
| P59635 | ORF7a protein (Accessory protein 7a) (Protein U122) (Protein X4) | EBI-25493519 | 0.37 |
| Q19QW5 | ORF6 protein (Accessory protein 6) (Non-structural protein 6) | EBI-25635410 | 0.61 |
| P08865 | 40S ribosomal protein SA (37 kDa laminin receptor precursor) (37LRP) (37/67 kDa laminin receptor) (LRP/LR) (67 kDa laminin receptor) (67LR) (Colon carcinoma laminin-binding protein) (Laminin receptor 1) (LamR) (Laminin-binding protein precursor p40) (LBP/p40) (Multidrug resistance-associated protein MGr1-Ag) (NEM/1CHD4) (Small ribosomal subunit protein uS2) | EBI-25507413 | 0.37 |
| Q15047 | Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1) | EBI-25507450 | 0.37 |
| Q9NY15 | Stabilin-1 (Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1) (FEEL-1) (MS-1 antigen) | EBI-25507454 | 0.37 |
| Q9BW92 | Threonine--tRNA ligase, mitochondrial (EC 6.1.1.3) (Threonyl-tRNA synthetase) (ThrRS) (Threonyl-tRNA synthetase-like 1) | EBI-25507458 | 0.37 |
| P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | EBI-25507462 | 0.60 |
| O95433 | Activator of 90 kDa heat shock protein ATPase homolog 1 (AHA1) (p38) | EBI-25507466 | 0.37 |
| Q8TF42 | Ubiquitin-associated and SH3 domain-containing protein B (EC 3.1.3.48) (Cbl-interacting protein p70) (Suppressor of T-cell receptor signaling 1) (STS-1) (T-cell ubiquitin ligand 2) (TULA-2) (Tyrosine-protein phosphatase STS1/TULA2) | EBI-25507481 | 0.37 |
| Q0VD86 | Protein INCA1 (Inhibitor of CDK interacting with cyclin A1) | EBI-25507485 | 0.37 |
| Q14653 | Interferon regulatory factor 3 (IRF-3) | EBI-25498708 | 0.66 |
| Q5JRX3 | Presequence protease, mitochondrial (hPreP) (EC 3.4.24.-) (Pitrilysin metalloproteinase 1) (Metalloprotease 1) (hMP1) | EBI-25507493 | 0.37 |
| Q99873 | Protein arginine N-methyltransferase 1 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT1) (Interferon receptor 1-bound protein 4) | EBI-25507497 | 0.37 |
| P62487 | DNA-directed RNA polymerase II subunit RPB7 (RNA polymerase II subunit B7) (DNA-directed RNA polymerase II subunit G) (RNA polymerase II 19 kDa subunit) (RPB19) | EBI-25507501 | 0.37 |
| Q9BTC0 | Death-inducer obliterator 1 (DIO-1) (hDido1) (Death-associated transcription factor 1) (DATF-1) | EBI-25507472 | 0.35 |
| Q93009 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-25507472 | 0.35 |
| Q6IEG0 | U11/U12 small nuclear ribonucleoprotein 48 kDa protein (U11/U12 snRNP 48 kDa protein) (U11/U12-48K) | EBI-25507472 | 0.35 |
| P78345 | Ribonuclease P protein subunit p38 (RNaseP protein p38) | EBI-25507472 | 0.35 |
| P35250 | Replication factor C subunit 2 (Activator 1 40 kDa subunit) (A1 40 kDa subunit) (Activator 1 subunit 2) (Replication factor C 40 kDa subunit) (RF-C 40 kDa subunit) (RFC40) | EBI-25507472 | 0.35 |
| O75131 | Copine-3 (Copine III) | EBI-25507472 | 0.35 |
| Q14008 | Cytoskeleton-associated protein 5 (Colonic and hepatic tumor overexpressed gene protein) (Ch-TOG) | EBI-25507472 | 0.53 |
| Q6Y7W6 | GRB10-interacting GYF protein 2 (PERQ amino acid-rich with GYF domain-containing protein 2) (Trinucleotide repeat-containing gene 15 protein) | EBI-25507801 | 0.53 |
| P21796 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) | EBI-25507801 | 0.35 |
| Q9UJZ1 | Stomatin-like protein 2, mitochondrial (SLP-2) (EPB72-like protein 2) (Paraprotein target 7) (Paratarg-7) | EBI-25507801 | 0.64 |
| Q96T58 | Msx2-interacting protein (SMART/HDAC1-associated repressor protein) (SPEN homolog) | EBI-25507801 | 0.35 |
| Q15758 | Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5) | EBI-25507801 | 0.35 |
| Q99623 | Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity) | EBI-25507801 | 0.64 |
| P35232 | Prohibitin 1 | EBI-25507801 | 0.64 |
| Q15154 | Pericentriolar material 1 protein (PCM-1) (hPCM-1) | EBI-25507801 | 0.35 |
| O14686 | Histone-lysine N-methyltransferase 2D (Lysine N-methyltransferase 2D) (EC 2.1.1.364) (ALL1-related protein) (Myeloid/lymphoid or mixed-lineage leukemia protein 2) | EBI-25507801 | 0.35 |
| O60573 | Eukaryotic translation initiation factor 4E type 2 (eIF-4E type 2) (eIF4E type 2) (Eukaryotic translation initiation factor 4E homologous protein) (Eukaryotic translation initiation factor 4E-like 3) (eIF4E-like protein 4E-LP) (mRNA cap-binding protein 4EHP) (h4EHP) (mRNA cap-binding protein type 3) | EBI-25507801 | 0.64 |
| Q7L2H7 | Eukaryotic translation initiation factor 3 subunit M (eIF3m) (Fetal lung protein B5) (hFL-B5) (PCI domain-containing protein 1) | EBI-25507801 | 0.53 |
| Q15751 | Probable E3 ubiquitin-protein ligase HERC1 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 1) (HECT-type E3 ubiquitin transferase HERC1) (p532) (p619) | EBI-25688256 | 0.40 |
| Q9BRX9 | WD repeat domain-containing protein 83 (Mitogen-activated protein kinase organizer 1) (MAPK organizer 1) | EBI-25688150 | 0.35 |
| Q9NZM4 | BRD4-interacting chromatin-remodeling complex-associated protein (Glioma tumor suppressor candidate region gene 1 protein) | EBI-25688150 | 0.35 |
| Q9H9G7 | Protein argonaute-3 (Argonaute3) (hAgo3) (EC 3.1.26.n2) (Argonaute RISC catalytic component 3) (Eukaryotic translation initiation factor 2C 3) (eIF-2C 3) (eIF2C 3) | EBI-25688150 | 0.35 |
| Q9BT78 | COP9 signalosome complex subunit 4 (SGN4) (Signalosome subunit 4) (JAB1-containing signalosome subunit 4) | EBI-25688150 | 0.35 |
| Q99798 | Aconitate hydratase, mitochondrial (Aconitase) (EC 4.2.1.3) (Citrate hydro-lyase) | EBI-25688150 | 0.35 |
| Q8TDY2 | RB1-inducible coiled-coil protein 1 (FAK family kinase-interacting protein of 200 kDa) (FIP200) | EBI-25688150 | 0.35 |
| Q6NWY9 | Pre-mRNA-processing factor 40 homolog B (Huntingtin yeast partner C) (Huntingtin-interacting protein C) | EBI-25688150 | 0.35 |
| Q15631 | Translin (EC 3.1.-.-) (Component 3 of promoter of RISC) (C3PO) | EBI-25688150 | 0.35 |
| Q15532 | Protein SSXT (Protein SYT) (Synovial sarcoma translocated to X chromosome protein) | EBI-25688150 | 0.35 |
| Q13228 | Methanethiol oxidase (MTO) (EC 1.8.3.4) (56 kDa selenium-binding protein) (SBP56) (SP56) (Selenium-binding protein 1) | EBI-25688150 | 0.35 |
| P55786 | Puromycin-sensitive aminopeptidase (PSA) (EC 3.4.11.14) (Cytosol alanyl aminopeptidase) (AAP-S) | EBI-25688150 | 0.35 |
| P52756 | RNA-binding protein 5 (Protein G15) (Putative tumor suppressor LUCA15) (RNA-binding motif protein 5) (Renal carcinoma antigen NY-REN-9) | EBI-25688150 | 0.35 |
| P40925 | Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Aromatic alpha-keto acid reductase) (KAR) (EC 1.1.1.96) (Cytosolic malate dehydrogenase) | EBI-25688150 | 0.35 |
| P28066 | Proteasome subunit alpha type-5 (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) (Proteasome zeta chain) | EBI-25688150 | 0.35 |
| P25789 | Proteasome subunit alpha type-4 (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome component C9) (Proteasome subunit L) | EBI-25688150 | 0.35 |
| P07954 | Fumarate hydratase, mitochondrial (Fumarase) (HsFH) (EC 4.2.1.2) | EBI-25688150 | 0.35 |
| O76064 | E3 ubiquitin-protein ligase RNF8 (hRNF8) (EC 2.3.2.27) (RING finger protein 8) (RING-type E3 ubiquitin transferase RNF8) | EBI-25688150 | 0.35 |
| O15498 | Synaptobrevin homolog YKT6 (EC 2.3.1.-) | EBI-25688150 | 0.35 |
| O14979 | Heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like) (hnRNP DL) (AU-rich element RNA-binding factor) (JKT41-binding protein) (Protein laAUF1) | EBI-25688150 | 0.35 |
| O14732 | Inositol monophosphatase 2 (IMP 2) (IMPase 2) (EC 3.1.3.25) (Inositol-1(or 4)-monophosphatase 2) (Myo-inositol monophosphatase A2) | EBI-25688150 | 0.35 |
| O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | EBI-25688150 | 0.35 |
| P09525 | Annexin A4 (35-beta calcimedin) (Annexin IV) (Annexin-4) (Carbohydrate-binding protein p33/p41) (Chromobindin-4) (Endonexin I) (Lipocortin IV) (P32.5) (PP4-X) (Placental anticoagulant protein II) (PAP-II) (Protein II) | EBI-25688210 | 0.35 |
| A6NHR9 | Structural maintenance of chromosomes flexible hinge domain-containing protein 1 (SMC hinge domain-containing protein 1) (EC 3.6.1.-) | EBI-25688210 | 0.35 |
| O75781 | Paralemmin-1 (Paralemmin) | EBI-25688221 | 0.35 |
| P07858 | Cathepsin B (EC 3.4.22.1) (APP secretase) (APPS) (Cathepsin B1) [Cleaved into: Cathepsin B light chain; Cathepsin B heavy chain] | EBI-25688221 | 0.35 |
| Q16719 | Kynureninase (EC 3.7.1.3) (L-kynurenine hydrolase) | EBI-25688245 | 0.35 |
| O43570 | Carbonic anhydrase 12 (EC 4.2.1.1) (Carbonate dehydratase XII) (Carbonic anhydrase XII) (CA-XII) (Tumor antigen HOM-RCC-3.1.3) | EBI-25688245 | 0.35 |
| Q86TG7 | Retrotransposon-derived protein PEG10 (Embryonal carcinoma differentiation-regulated protein) (Mammalian retrotransposon-derived protein 2) (Myelin expression factor 3-like protein 1) (MEF3-like protein 1) (Paternally expressed gene 10 protein) (Retrotransposon gag domain-containing protein 3) (Retrotransposon-derived gag-like polyprotein) (Ty3/Gypsy-like protein) | EBI-25688201 | 0.40 |
| P06400 | Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110) | EBI-25684934 | 0.56 |
| Q9UHD2 | Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1) | EBI-25751044 | 0.40 |
| AY394850.2 | EBI-25752076 | 0.44 | |
| Q9Y657 | Spindlin-1 (Ovarian cancer-related protein) (Spindlin1) | EBI-25762307 | 0.35 |
| Q96K19 | E3 ubiquitin-protein ligase RNF170 (EC 2.3.2.27) (Putative LAG1-interacting protein) (RING finger protein 170) (RING-type E3 ubiquitin transferase RNF170) | EBI-25762307 | 0.35 |
| Q9UBN7 | Histone deacetylase 6 (HD6) (EC 3.5.1.98) (Tubulin-lysine deacetylase HDAC6) (EC 3.5.1.-) | EBI-25762307 | 0.35 |
| O94905 | Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2) | EBI-25762307 | 0.35 |
| O75477 | Erlin-1 (Endoplasmic reticulum lipid raft-associated protein 1) (Protein KE04) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1) (SPFH domain-containing protein 1) | EBI-25762307 | 0.35 |
| P51798 | H(+)/Cl(-) exchange transporter 7 (Chloride channel 7 alpha subunit) (Chloride channel protein 7) (ClC-7) | EBI-25762307 | 0.35 |
| Q8N4V1 | ER membrane protein complex subunit 5 (Membrane magnesium transporter 1) (Transmembrane protein 32) | EBI-25762541 | 0.35 |
| P62699 | Protein yippee-like 5 | EBI-25762541 | 0.53 |
| Q9H7D7 | WD repeat-containing protein 26 (CUL4- and DDB1-associated WDR protein 2) (Myocardial ischemic preconditioning up-regulated protein 2) | EBI-25762541 | 0.53 |
| Q9BQB6 | Vitamin K epoxide reductase complex subunit 1 (EC 1.17.4.4) (Vitamin K1 2,3-epoxide reductase subunit 1) | EBI-25762541 | 0.35 |
| Q99942 | E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (RING finger protein 5) (Ram1 homolog) (HsRma1) | EBI-25762541 | 0.35 |
| Q9H871 | E3 ubiquitin-protein transferase RMND5A (EC 2.3.2.27) (P44CTLH) (Protein RMD5 homolog A) | EBI-25762541 | 0.35 |
| Q96S59 | Ran-binding protein 9 (RanBP9) (BPM-L) (BPM90) (Ran-binding protein M) (RanBPM) (RanBP7) | EBI-25762541 | 0.35 |
| Q6VN20 | Ran-binding protein 10 (RanBP10) | EBI-25762541 | 0.53 |
| Q9UKZ9 | Procollagen C-endopeptidase enhancer 2 (Procollagen COOH-terminal proteinase enhancer 2) (PCPE-2) (Procollagen C-proteinase enhancer 2) | EBI-25762541 | 0.35 |
| O75592 | E3 ubiquitin-protein ligase MYCBP2 (EC 2.3.2.33) (Myc-binding protein 2) (Protein associated with Myc) | EBI-25762541 | 0.35 |
| Q9UL63 | Muskelin | EBI-25762541 | 0.35 |
| Q7L5Y9 | E3 ubiquitin-protein transferase MAEA (EC 2.3.2.27) (Cell proliferation-inducing gene 5 protein) (Erythroblast macrophage protein) (Human lung cancer oncogene 10 protein) (HLC-10) (Macrophage erythroblast attacher) (P44EMLP) | EBI-25762541 | 0.35 |
| Q13907 | Isopentenyl-diphosphate Delta-isomerase 1 (EC 5.3.3.2) (Isopentenyl pyrophosphate isomerase 1) (IPP isomerase 1) (IPPI1) | EBI-25762541 | 0.35 |
| Q15011 | Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (Methyl methanesulfonate (MMF)-inducible fragment protein 1) | EBI-25762541 | 0.35 |
| Q9NWU2 | Glucose-induced degradation protein 8 homolog (Two hybrid-associated protein 1 with RanBPM) (Twa1) | EBI-25762541 | 0.53 |
| P0C2W1 | F-box/SPRY domain-containing protein 1 (F-box only protein 45) (hFbxo45) | EBI-25762541 | 0.35 |
| Q9ULG6 | Cell cycle progression protein 1 (Cell cycle progression restoration protein 8) | EBI-25762541 | 0.35 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-25762541 | 0.35 |
| Q8IUR7 | Armadillo repeat-containing protein 8 | EBI-25762541 | 0.35 |
| Q13557 | Calcium/calmodulin-dependent protein kinase type II subunit delta (CaM kinase II subunit delta) (CaMK-II subunit delta) (EC 2.7.11.17) | EBI-25825454 | 0.57 |
| Q96PM5 | RING finger and CHY zinc finger domain-containing protein 1 (EC 2.3.2.27) (Androgen receptor N-terminal-interacting protein) (CH-rich-interacting match with PLAG1) (E3 ubiquitin-protein ligase Pirh2) (RING finger protein 199) (RING-type E3 ubiquitin transferase RCHY1) (Zinc finger protein 363) (p53-induced RING-H2 protein) (hPirh2) | EBI-25825454 | 0.59 |
| P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | EBI-25825787 | 0.35 |
| Q92499 | ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD box protein 1) (DEAD box protein retinoblastoma) (DBP-RB) | EBI-25827273 | 0.40 |
| P49643 | DNA primase large subunit (DNA primase 58 kDa subunit) (p58) | EBI-26376937 | 0.53 |
| P49642 | DNA primase small subunit (EC 2.7.7.102) (DNA primase 49 kDa subunit) (p49) | EBI-26376937 | 0.53 |
| P09884 | DNA polymerase alpha catalytic subunit (EC 2.7.7.7) (DNA polymerase alpha catalytic subunit p180) | EBI-26376937 | 0.53 |
| Q14181 | DNA polymerase alpha subunit B (DNA polymerase alpha 70 kDa subunit) | EBI-26376937 | 0.53 |
| Q969X5 | Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ER-Golgi intermediate compartment 32 kDa protein) (ERGIC-32) | EBI-26376953 | 0.35 |
| Q6Q0C0 | E3 ubiquitin-protein ligase TRAF7 (EC 2.3.2.27) (RING finger and WD repeat-containing protein 1) (RING finger protein 119) (RING-type E3 ubiquitin transferase TRAF7) (TNF receptor-associated factor 7) | EBI-26376953 | 0.35 |
| O15078 | Centrosomal protein of 290 kDa (Cep290) (Bardet-Biedl syndrome 14 protein) (Cancer/testis antigen 87) (CT87) (Nephrocystin-6) (Tumor antigen se2-2) | EBI-26376977 | 0.35 |
| Q9HCJ0 | Trinucleotide repeat-containing gene 6C protein | EBI-26376977 | 0.35 |
| Q9HAU0 | Pleckstrin homology domain-containing family A member 5 (PH domain-containing family A member 5) (Phosphoinositol 3-phosphate-binding protein 2) (PEPP-2) | EBI-26376977 | 0.35 |
| Q9H2H8 | Peptidyl-prolyl cis-trans isomerase-like 3 (PPIase) (EC 5.2.1.8) (Cyclophilin J) (CyPJ) (Cyclophilin-like protein PPIL3) (Rotamase PPIL3) | EBI-26376977 | 0.35 |
| Q96M11 | Centriolar and ciliogenesis-associated protein HYLS1 (Hydrolethalus syndrome protein 1) | EBI-26376977 | 0.35 |
| Q96IZ5 | RNA-binding protein 41 (RNA-binding motif protein 41) | EBI-26376977 | 0.35 |
| Q92908 | Transcription factor GATA-6 (GATA-binding factor 6) | EBI-26376977 | 0.35 |
| Q92615 | La-related protein 4B (La ribonucleoprotein domain family member 4B) (La ribonucleoprotein domain family member 5) (La-related protein 5) | EBI-26376977 | 0.35 |
| Q8IWR0 | Zinc finger CCCH domain-containing protein 7A | EBI-26376977 | 0.35 |
| Q86SQ0 | Pleckstrin homology-like domain family B member 2 (Protein LL5-beta) | EBI-26376977 | 0.35 |
| Q70EL1 | Inactive ubiquitin carboxyl-terminal hydrolase 54 (Inactive ubiquitin-specific peptidase 54) | EBI-26376977 | 0.35 |
| Q6ZRI6 | Uncharacterized protein C15orf39 | EBI-26376977 | 0.35 |
| Q6UUV7 | CREB-regulated transcription coactivator 3 (Transducer of regulated cAMP response element-binding protein 3) (TORC-3) (Transducer of CREB protein 3) | EBI-26376977 | 0.35 |
| Q5VUA4 | Zinc finger protein 318 (Endocrine regulatory protein) | EBI-26376977 | 0.35 |
| Q5EBL8 | PDZ domain-containing protein 11 (ATPase-interacting PDZ protein) (Plasma membrane calcium ATPase-interacting single-PDZ protein) (PMCA-interacting single-PDZ protein) | EBI-26376977 | 0.35 |
| Q4KMZ1 | IQ domain-containing protein C | EBI-26376977 | 0.35 |
| Q2T9J0 | Peroxisomal leader peptide-processing protease (EC 3.4.21.-) (Trypsin domain-containing protein 1) [Cleaved into: Peroxisomal leader peptide-processing protease, 15 kDa form; Peroxisomal leader peptide-processing protease, 45 kDa form] | EBI-26376977 | 0.35 |
| Q2NL68 | Proline and serine-rich protein 3 | EBI-26376977 | 0.35 |
| Q13948 | Protein CASP | EBI-26376977 | 0.35 |
| Q13615 | Myotubularin-related protein 3 (EC 3.1.3.48) (FYVE domain-containing dual specificity protein phosphatase 1) (FYVE-DSP1) (Phosphatidylinositol-3,5-bisphosphate 3-phosphatase) (EC 3.1.3.95) (Phosphatidylinositol-3-phosphate phosphatase) (EC 3.1.3.64) (Zinc finger FYVE domain-containing protein 10) | EBI-26376977 | 0.35 |
| Q13546 | Receptor-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (Cell death protein RIP) (Receptor-interacting protein 1) (RIP-1) | EBI-26376977 | 0.35 |
| Q13033 | Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen) | EBI-26376977 | 0.35 |
| O95391 | Pre-mRNA-splicing factor SLU7 (hSlu7) | EBI-26376977 | 0.35 |
| O75506 | Heat shock factor-binding protein 1 (Nasopharyngeal carcinoma-associated antigen 13) (NPC-A-13) | EBI-26376977 | 0.35 |
| O43303 | Centriolar coiled-coil protein of 110 kDa (Centrosomal protein of 110 kDa) (CP110) (Cep110) | EBI-26376977 | 0.35 |
| O15014 | Zinc finger protein 609 | EBI-26376977 | 0.35 |
| A3KN83 | Protein strawberry notch homolog 1 (Monocyte protein 3) (MOP-3) | EBI-26376977 | 0.35 |
| P17612 | cAMP-dependent protein kinase catalytic subunit alpha (PKA C-alpha) (EC 2.7.11.11) | EBI-26377017 | 0.35 |
| Q9Y2I6 | Ninein-like protein | EBI-26377017 | 0.35 |
| Q8WWI1 | LIM domain only protein 7 (LMO-7) (F-box only protein 20) (LOMP) | EBI-26377017 | 0.35 |
| Q8N4C6 | Ninein (hNinein) (Glycogen synthase kinase 3 beta-interacting protein) (GSK3B-interacting protein) | EBI-26377017 | 0.35 |
| P35579 | Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) | EBI-26377017 | 0.35 |
| Q9Y608 | Leucine-rich repeat flightless-interacting protein 2 (LRR FLII-interacting protein 2) | EBI-26377017 | 0.35 |
| Q9Y4I1 | Unconventional myosin-Va (Dilute myosin heavy chain, non-muscle) (Myosin heavy chain 12) (Myosin-12) (Myoxin) | EBI-26377017 | 0.35 |
| Q9UPQ0 | LIM and calponin homology domains-containing protein 1 | EBI-26377017 | 0.35 |
| Q9UPN4 | Centrosomal protein of 131 kDa (5-azacytidine-induced protein 1) (Pre-acrosome localization protein 1) | EBI-26377017 | 0.35 |
| Q9ULV0 | Unconventional myosin-Vb | EBI-26377017 | 0.35 |
| Q9H0E2 | Toll-interacting protein | EBI-26377017 | 0.35 |
| Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | EBI-26377017 | 0.35 |
| Q9BV19 | Uncharacterized protein C1orf50 | EBI-26377017 | 0.35 |
| Q9BQQ3 | Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi phosphoprotein 5) (GOLPH5) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65) | EBI-26377017 | 0.35 |
| Q99996 | A-kinase anchor protein 9 (AKAP-9) (A-kinase anchor protein 350 kDa) (AKAP 350) (hgAKAP 350) (A-kinase anchor protein 450 kDa) (AKAP 450) (AKAP 120-like protein) (Centrosome- and Golgi-localized PKN-associated protein) (CG-NAP) (Protein hyperion) (Protein kinase A-anchoring protein 9) (PRKA9) (Protein yotiao) | EBI-26377017 | 0.35 |
| Q96SN8 | CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) (Centrosome-associated protein 215) | EBI-26377017 | 0.35 |
| Q96N16 | Janus kinase and microtubule-interacting protein 1 (GABA-B receptor-binding protein) (Multiple alpha-helices and RNA-linker protein 1) (Marlin-1) | EBI-26377017 | 0.35 |
| Q96II8 | DISP complex protein LRCH3 (Leucine-rich repeat and calponin homology domain-containing protein 3) | EBI-26377017 | 0.35 |
| Q92995 | Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.4.19.12) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) | EBI-26377017 | 0.35 |
| Q92614 | Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210) | EBI-26377017 | 0.35 |
| Q8WXW3 | Progesterone-induced-blocking factor 1 (PIBF) (Centrosomal protein of 90 kDa) (CEP90) | EBI-26377017 | 0.35 |
| Q8TD10 | Mirror-image polydactyly gene 1 protein | EBI-26377017 | 0.35 |
| Q8IUD2 | ELKS/Rab6-interacting/CAST family member 1 (ERC-1) (Rab6-interacting protein 2) | EBI-26377017 | 0.35 |
| Q7Z406 | Myosin-14 (Myosin heavy chain 14) (Myosin heavy chain, non-muscle IIc) (Non-muscle myosin heavy chain IIc) (NMHC II-C) | EBI-26377017 | 0.35 |
| Q6ZVM7 | TOM1-like protein 2 (Target of Myb-like protein 2) | EBI-26377017 | 0.35 |
| Q66GS9 | Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4) | EBI-26377017 | 0.35 |
| Q5VUJ6 | Leucine-rich repeat and calponin homology domain-containing protein 2 | EBI-26377017 | 0.35 |
| Q5VU43 | Myomegalin (Cardiomyopathy-associated protein 2) (Phosphodiesterase 4D-interacting protein) | EBI-26377017 | 0.35 |
| Q5VT06 | Centrosome-associated protein 350 (Cep350) (Centrosome-associated protein of 350 kDa) | EBI-26377017 | 0.35 |
| Q14789 | Golgin subfamily B member 1 (372 kDa Golgi complex-associated protein) (GCP372) (Giantin) (Macrogolgin) | EBI-26377017 | 0.35 |
| Q13045 | Protein flightless-1 homolog | EBI-26377017 | 0.35 |
| Q12965 | Unconventional myosin-Ie (Myosin-Ic) (Unconventional myosin 1E) | EBI-26377017 | 0.35 |
| Q08379 | Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95) | EBI-26377017 | 0.35 |
| Q08378 | Golgin subfamily A member 3 (Golgi complex-associated protein of 170 kDa) (GCP170) (Golgin-160) | EBI-26377017 | 0.35 |
| Q04726 | Transducin-like enhancer protein 3 (Enhancer of split groucho-like protein 3) (ESG3) | EBI-26377017 | 0.35 |
| Q04724 | Transducin-like enhancer protein 1 (E(Sp1) homolog) (Enhancer of split groucho-like protein 1) (ESG1) | EBI-26377017 | 0.35 |
| P67936 | Tropomyosin alpha-4 chain (TM30p1) (Tropomyosin-4) | EBI-26377017 | 0.35 |
| P35241 | Radixin | EBI-26377017 | 0.35 |
| P28289 | Tropomodulin-1 (Erythrocyte tropomodulin) (E-Tmod) | EBI-26377017 | 0.35 |
| P14649 | Myosin light chain 6B (Myosin light chain 1 slow-twitch muscle A isoform) (MLC1sa) (Smooth muscle and nonmuscle myosin light chain alkali 6B) | EBI-26377017 | 0.35 |
| P13861 | cAMP-dependent protein kinase type II-alpha regulatory subunit | EBI-26377017 | 0.35 |
| P09493 | Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1) | EBI-26377017 | 0.35 |
| P06396 | Gelsolin (AGEL) (Actin-depolymerizing factor) (ADF) (Brevin) | EBI-26377017 | 0.35 |
| O95684 | Centrosomal protein 43 (FGFR1 oncogene partner) | EBI-26377017 | 0.35 |
| O95613 | Pericentrin (Kendrin) (Pericentrin-B) | EBI-26377017 | 0.35 |
| O75381 | Peroxisomal membrane protein PEX14 (PTS1 receptor-docking protein) (Peroxin-14) (Peroxisomal membrane anchor protein PEX14) | EBI-26377017 | 0.35 |
| O60784 | Target of Myb1 membrane trafficking protein (Target of Myb protein 1) | EBI-26377017 | 0.35 |
| O60237 | Protein phosphatase 1 regulatory subunit 12B (Myosin phosphatase-targeting subunit 2) (Myosin phosphatase target subunit 2) | EBI-26377017 | 0.35 |
| O14908 | PDZ domain-containing protein GIPC1 (GAIP C-terminus-interacting protein) (RGS-GAIP-interacting protein) (RGS19-interacting protein 1) (Synectin) (Tax interaction protein 2) (TIP-2) | EBI-26377017 | 0.35 |
| O14639 | Actin-binding LIM protein 1 (abLIM-1) (Actin-binding LIM protein family member 1) (Actin-binding double zinc finger protein) (LIMAB1) (Limatin) | EBI-26377017 | 0.35 |
| Q9NXA8 | NAD-dependent protein deacylase sirtuin-5, mitochondrial (EC 2.3.1.-) (Regulatory protein SIR2 homolog 5) (SIR2-like protein 5) | EBI-26377088 | 0.35 |
| Q96JN8 | Neuralized-like protein 4 | EBI-26377088 | 0.35 |
| P12268 | Inosine-5'-monophosphate dehydrogenase 2 (IMP dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (Inosine-5'-monophosphate dehydrogenase type II) (IMP dehydrogenase II) (IMPDH-II) | EBI-26377088 | 0.35 |
| P06280 | Alpha-galactosidase A (EC 3.2.1.22) (Alpha-D-galactosidase A) (Alpha-D-galactoside galactohydrolase) (Galactosylgalactosylglucosylceramidase GLA) (Melibiase) (Agalsidase) | EBI-26377088 | 0.35 |
| O95714 | E3 ubiquitin-protein ligase HERC2 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 2) (HECT-type E3 ubiquitin transferase HERC2) | EBI-26377088 | 0.35 |
| P62330 | ADP-ribosylation factor 6 (EC 3.6.5.2) | EBI-26377105 | 0.40 |
| Q9Y2S7 | Polymerase delta-interacting protein 2 (38 kDa DNA polymerase delta interaction protein) (p38) | EBI-26377113 | 0.35 |
| Q9UKF6 | Cleavage and polyadenylation specificity factor subunit 3 (EC 3.1.27.-) (Cleavage and polyadenylation specificity factor 73 kDa subunit) (CPSF 73 kDa subunit) (mRNA 3'-end-processing endonuclease CPSF-73) | EBI-26377113 | 0.35 |
| Q5SVZ6 | Zinc finger MYM-type protein 1 | EBI-26377113 | 0.35 |
| Q567U6 | Coiled-coil domain-containing protein 93 | EBI-26377113 | 0.35 |
| P28838 | Cytosol aminopeptidase (EC 3.4.11.1) (Cysteinylglycine-S-conjugate dipeptidase) (EC 3.4.13.23) (Leucine aminopeptidase 3) (LAP-3) (Leucyl aminopeptidase) (Peptidase S) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) | EBI-26377113 | 0.35 |
| O60232 | Protein ZNRD2 (Autoantigen p27) (Sjoegren syndrome/scleroderma autoantigen 1) (Zinc ribbon domain-containing protein 2) | EBI-26377113 | 0.35 |
| Q13347 | Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 subunit 2) (TGF-beta receptor-interacting protein 1) (TRIP-1) (eIF-3-beta) (eIF3 p36) | EBI-26377128 | 0.35 |
| P55884 | Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Eukaryotic translation initiation factor 3 subunit 9) (Prt1 homolog) (hPrt1) (eIF-3-eta) (eIF3 p110) (eIF3 p116) | EBI-26377128 | 0.35 |
| O15371 | Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66) | EBI-26377128 | 0.35 |
| Q9Y262 | Eukaryotic translation initiation factor 3 subunit L (eIF3l) (Eukaryotic translation initiation factor 3 subunit 6-interacting protein) (Eukaryotic translation initiation factor 3 subunit E-interacting protein) | EBI-26377128 | 0.35 |
| Q9UBQ5 | Eukaryotic translation initiation factor 3 subunit K (eIF3k) (Eukaryotic translation initiation factor 3 subunit 12) (Muscle-specific gene M9 protein) (PLAC-24) (eIF-3 p25) (eIF-3 p28) | EBI-26377128 | 0.35 |
| Q9C037 | E3 ubiquitin-protein ligase TRIM4 (EC 2.3.2.27) (RING finger protein 87) (RING-type E3 ubiquitin transferase TRIM4) (Tripartite motif-containing protein 4) | EBI-26377128 | 0.35 |
| Q99613 | Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110) | EBI-26377128 | 0.35 |
| Q86UK7 | E3 ubiquitin-protein ligase ZNF598 (EC 2.3.2.27) (Zinc finger protein 598) | EBI-26377128 | 0.35 |
| Q6NUN9 | Zinc finger protein 746 (Parkin-interacting substrate) (PARIS) | EBI-26377128 | 0.35 |
| Q14152 | Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) | EBI-26377128 | 0.35 |
| P60228 | Eukaryotic translation initiation factor 3 subunit E (eIF3e) (Eukaryotic translation initiation factor 3 subunit 6) (Viral integration site protein INT-6 homolog) (eIF-3 p48) | EBI-26377128 | 0.35 |
| P52306 | Rap1 GTPase-GDP dissociation stimulator 1 (Exchange factor smgGDS) (SMG GDS protein) (SMG P21 stimulatory GDP/GTP exchange protein) | EBI-26377128 | 0.35 |
| O75822 | Eukaryotic translation initiation factor 3 subunit J (eIF3j) (Eukaryotic translation initiation factor 3 subunit 1) (eIF-3-alpha) (eIF3 p35) | EBI-26377128 | 0.35 |
| O15372 | Eukaryotic translation initiation factor 3 subunit H (eIF3h) (Eukaryotic translation initiation factor 3 subunit 3) (eIF-3-gamma) (eIF3 p40 subunit) | EBI-26377128 | 0.35 |
| O00303 | Eukaryotic translation initiation factor 3 subunit F (eIF3f) (Deubiquitinating enzyme eIF3f) (EC 3.4.19.12) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47) | EBI-26377128 | 0.35 |
| P14735 | Insulin-degrading enzyme (EC 3.4.24.56) (Abeta-degrading protease) (Insulin protease) (Insulinase) (Insulysin) | EBI-26377154 | 0.35 |
| P07203 | Glutathione peroxidase 1 (GPx-1) (GSHPx-1) (EC 1.11.1.9) (Cellular glutathione peroxidase) | EBI-26377169 | 0.35 |
| Q9NXH9 | tRNA (guanine(26)-N(2))-dimethyltransferase (EC 2.1.1.216) (tRNA 2,2-dimethylguanosine-26 methyltransferase) (tRNA(guanine-26,N(2)-N(2)) methyltransferase) (tRNA(m(2,2)G26)dimethyltransferase) | EBI-26377169 | 0.35 |
| Q9Y3D7 | Mitochondrial import inner membrane translocase subunit TIM16 (Mitochondria-associated granulocyte macrophage CSF-signaling molecule) (Presequence translocated-associated motor subunit PAM16) | EBI-26377188 | 0.35 |
| Q9NYP7 | Elongation of very long chain fatty acids protein 5 (EC 2.3.1.199) (3-keto acyl-CoA synthase ELOVL5) (ELOVL fatty acid elongase 5) (ELOVL FA elongase 5) (Fatty acid elongase 1) (hELO1) (Very long chain 3-ketoacyl-CoA synthase 5) (Very long chain 3-oxoacyl-CoA synthase 5) | EBI-26377188 | 0.35 |
| Q9BQE4 | Selenoprotein S (SelS) (VCP-interacting membrane protein) | EBI-26377188 | 0.35 |
| Q96ER9 | Mitochondrial potassium channel (MITOK) (Coiled-coil domain-containing protein 51) | EBI-26377188 | 0.35 |
| Q96A26 | Protein FAM162A (E2-induced gene 5 protein) (Growth and transformation-dependent protein) (HGTD-P) | EBI-26377188 | 0.35 |
| Q8WUY8 | Probable N-acetyltransferase 14 (EC 2.3.1.-) (K562 cell-derived leucine-zipper-like protein 1) | EBI-26377188 | 0.35 |
| Q8WTV0 | Scavenger receptor class B member 1 (SRB1) (CD36 and LIMPII analogous 1) (CLA-1) (CD36 antigen-like 1) (Collagen type I receptor, thrombospondin receptor-like 1) (SR-BI) (CD antigen CD36) | EBI-26377188 | 0.35 |
| Q8NBX0 | Saccharopine dehydrogenase-like oxidoreductase (EC 1.-.-.-) | EBI-26377188 | 0.35 |
| Q8IUR0 | Trafficking protein particle complex subunit 5 | EBI-26377188 | 0.35 |
| Q7LGA3 | Heparan sulfate 2-O-sulfotransferase 1 (2-O-sulfotransferase) (2OST) (EC 2.8.2.-) | EBI-26377188 | 0.35 |
| Q6P1Q0 | LETM1 domain-containing protein 1 (Cervical cancer 1 proto-oncogene protein p40) (Cervical cancer proto-oncogene 2 protein) (HCCR-1) (HCRR-2) | EBI-26377188 | 0.35 |
| Q5VT66 | Mitochondrial amidoxime-reducing component 1 (mARC1) (EC 1.7.-.-) (Molybdenum cofactor sulfurase C-terminal domain-containing protein 1) (MOSC domain-containing protein 1) (Moco sulfurase C-terminal domain-containing protein 1) | EBI-26377188 | 0.35 |
| Q2TAA5 | GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase (EC 2.4.1.131) (Asparagine-linked glycosylation protein 11 homolog) (Glycolipid 2-alpha-mannosyltransferase) | EBI-26377188 | 0.35 |
| Q12907 | Vesicular integral-membrane protein VIP36 (Glycoprotein GP36b) (Lectin mannose-binding 2) (Vesicular integral-membrane protein 36) (VIP36) | EBI-26377188 | 0.35 |
| P61006 | Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel) | EBI-26377188 | 0.35 |
| P00387 | NADH-cytochrome b5 reductase 3 (B5R) (Cytochrome b5 reductase) (EC 1.6.2.2) (Diaphorase-1) | EBI-26377188 | 0.35 |
| O94766 | Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 (EC 2.4.1.135) (Beta-1,3-glucuronyltransferase 3) (Glucuronosyltransferase I) (GlcAT-I) (UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase) (GlcUAT-I) | EBI-26377188 | 0.35 |
| A8MTT3 | Protein CEBPZOS (CEBPZ antisense RNA 1) (CEBPZ opposite strand) | EBI-26377188 | 0.35 |
| Q9BSC4 | Nucleolar protein 10 | EBI-26377216 | 0.35 |
| Q9Y3B7 | 39S ribosomal protein L11, mitochondrial (L11mt) (MRP-L11) (Mitochondrial large ribosomal subunit protein uL11m) | EBI-26377216 | 0.35 |
| Q9NQT5 | Exosome complex component RRP40 (Exosome component 3) (Ribosomal RNA-processing protein 40) (p10) | EBI-26377216 | 0.35 |
| Q9NQT4 | Exosome complex component RRP46 (Chronic myelogenous leukemia tumor antigen 28) (Exosome component 5) (Ribosomal RNA-processing protein 46) (p12B) | EBI-26377216 | 0.35 |
| Q8NEJ9 | Neuroguidin (Centromere accumulated nuclear protein 1) (CANu1) (EIF4E-binding protein) | EBI-26377216 | 0.35 |
| P82675 | 28S ribosomal protein S5, mitochondrial (MRP-S5) (S5mt) (Mitochondrial small ribosomal subunit protein uS5m) | EBI-26377216 | 0.35 |
| Q9ULT8 | E3 ubiquitin-protein ligase HECTD1 (EC 2.3.2.26) (E3 ligase for inhibin receptor) (EULIR) (HECT domain-containing protein 1) | EBI-26377216 | 0.35 |
| Q9UL40 | Zinc finger protein 346 (Just another zinc finger protein) | EBI-26377216 | 0.35 |
| Q9UGI8 | Testin (TESS) | EBI-26377216 | 0.35 |
| Q9NY61 | Protein AATF (Apoptosis-antagonizing transcription factor) (Rb-binding protein Che-1) | EBI-26377216 | 0.35 |
| Q9H6F5 | Coiled-coil domain-containing protein 86 (Cytokine-induced protein with coiled-coil domain) | EBI-26377216 | 0.35 |
| Q96FK6 | WD repeat-containing protein 89 | EBI-26377216 | 0.35 |
| Q96B26 | Exosome complex component RRP43 (Exosome component 8) (Opa-interacting protein 2) (OIP-2) (Ribosomal RNA-processing protein 43) (p9) | EBI-26377216 | 0.35 |
| Q8N983 | 39S ribosomal protein L43, mitochondrial (L43mt) (MRP-L43) (Mitochondrial large ribosomal subunit protein mL43) (Mitochondrial ribosomal protein bMRP36a) | EBI-26377216 | 0.35 |
| Q7L2J0 | 7SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog) | EBI-26377216 | 0.35 |
| Q4G0J3 | La-related protein 7 (La ribonucleoprotein domain family member 7) (hLARP7) (P-TEFb-interaction protein for 7SK stability) (PIP7S) | EBI-26377216 | 0.35 |
| Q15397 | Pumilio homolog 3 (HBV X-transactivated gene 5 protein) (HBV XAg-transactivated protein 5) (Minor histocompatibility antigen HA-8) (HLA-HA8) | EBI-26377216 | 0.35 |
| Q14692 | Ribosome biogenesis protein BMS1 homolog (Ribosome assembly protein BMS1 homolog) | EBI-26377216 | 0.35 |
| Q13206 | Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10) | EBI-26377216 | 0.35 |
| P09132 | Signal recognition particle 19 kDa protein (SRP19) | EBI-26377216 | 0.35 |
| O95260 | Arginyl-tRNA--protein transferase 1 (Arginyltransferase 1) (R-transferase 1) (EC 2.3.2.8) (Arginine-tRNA--protein transferase 1) | EBI-26377216 | 0.35 |
| O76094 | Signal recognition particle subunit SRP72 (SRP72) (Signal recognition particle 72 kDa protein) | EBI-26377216 | 0.35 |
| O00566 | U3 small nucleolar ribonucleoprotein protein MPP10 (M phase phosphoprotein 10) | EBI-26377216 | 0.35 |
| P35556 | Fibrillin-2 [Cleaved into: Placensin] | EBI-26377247 | 0.35 |
| Q8TD19 | Serine/threonine-protein kinase Nek9 (EC 2.7.11.1) (Nercc1 kinase) (Never in mitosis A-related kinase 9) (NimA-related protein kinase 9) (NimA-related kinase 8) (Nek8) | EBI-26377247 | 0.35 |
| Q8N1G2 | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (EC 2.1.1.57) (Cap methyltransferase 1) (Cap1 2'O-ribose methyltransferase 1) (MTr1) (hMTr1) (FtsJ methyltransferase domain-containing protein 2) (Interferon-stimulated gene 95 kDa protein) (ISG95) | EBI-26377247 | 0.35 |
| Q8N0X7 | Spartin (Spastic paraplegia 20 protein) (Trans-activated by hepatitis C virus core protein 1) | EBI-26377247 | 0.35 |
| Q86YT6 | E3 ubiquitin-protein ligase MIB1 (EC 2.3.2.27) (DAPK-interacting protein 1) (DIP-1) (Mind bomb homolog 1) (RING-type E3 ubiquitin transferase MIB1) (Zinc finger ZZ type with ankyrin repeat domain protein 2) | EBI-26377247 | 0.35 |
| Q14232 | Translation initiation factor eIF-2B subunit alpha (eIF-2B GDP-GTP exchange factor subunit alpha) | EBI-26377247 | 0.35 |
| P61962 | DDB1- and CUL4-associated factor 7 (WD repeat-containing protein 68) (WD repeat-containing protein An11 homolog) | EBI-26377247 | 0.35 |
| O00142 | Thymidine kinase 2, mitochondrial (EC 2.7.1.21) (2'-deoxyuridine kinase TK2) (EC 2.7.1.74) (Deoxycytidine kinase TK2) (EC 2.7.1.-) (Mt-TK) | EBI-26377247 | 0.35 |
| P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-26451065 | 0.40 |
| Q64339 | Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein) | EBI-26583749 | 0.56 |
| P0CG48 | Polyubiquitin-C [Cleaved into: Ubiquitin] | EBI-26585786 | 0.56 |
| P31151 | Protein S100-A7 (Psoriasin) (S100 calcium-binding protein A7) | EBI-26584254 | 0.35 |
| P05109 | Protein S100-A8 (Calgranulin-A) (Calprotectin L1L subunit) (Cystic fibrosis antigen) (CFAG) (Leukocyte L1 complex light chain) (Migration inhibitory factor-related protein 8) (MRP-8) (p8) (S100 calcium-binding protein A8) (Urinary stone protein band A) | EBI-26584254 | 0.35 |
| P59665 | Neutrophil defensin 1 (Defensin, alpha 1) (HNP-1) (HP-1) (HP1) [Cleaved into: HP 1-56; Neutrophil defensin 2 (HNP-2) (HP-2) (HP2)] | EBI-26584254 | 0.35 |
| P07339 | Cathepsin D (EC 3.4.23.5) [Cleaved into: Cathepsin D light chain; Cathepsin D heavy chain] | EBI-26584254 | 0.35 |
| P47929 | Galectin-7 (Gal-7) (HKL-14) (PI7) (p53-induced gene 1 protein) | EBI-26584254 | 0.35 |
| Q96P63 | Serpin B12 | EBI-26584254 | 0.35 |
| P48594 | Serpin B4 (Leupin) (Peptidase inhibitor 11) (PI-11) (Squamous cell carcinoma antigen 2) (SCCA-2) | EBI-26584254 | 0.35 |
| P29508 | Serpin B3 (Protein T4-A) (Squamous cell carcinoma antigen 1) (SCCA-1) | EBI-26584254 | 0.35 |
| P06702 | Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9) | EBI-26584254 | 0.35 |
| P05161 | Ubiquitin-like protein ISG15 (Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein) (hUCRP) | EBI-26584341 | 0.54 |
| P25963 | NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3) | EBI-26585885 | 0.44 |
| Q13616 | Cullin-1 (CUL-1) | EBI-26585276 | 0.44 |
| Q9BYX4 | Interferon-induced helicase C domain-containing protein 1 (EC 3.6.4.13) (Clinically amyopathic dermatomyositis autoantigen 140 kDa) (CADM-140 autoantigen) (Helicase with 2 CARD domains) (Helicard) (Interferon-induced with helicase C domain protein 1) (Melanoma differentiation-associated protein 5) (MDA-5) (Murabutide down-regulated protein) (RIG-I-like receptor 2) (RLR-2) (RNA helicase-DEAD box protein 116) | EBI-26895226 | 0.40 |
| Q96C36 | Pyrroline-5-carboxylate reductase 2 (P5C reductase 2) (P5CR 2) (EC 1.5.1.2) | EBI-27129499 | 0.46 |
| P32322 | Pyrroline-5-carboxylate reductase 1, mitochondrial (P5C reductase 1) (P5CR 1) (EC 1.5.1.2) | EBI-27129499 | 0.46 |
| Q96CT2 | Kelch-like protein 29 (Kelch repeat and BTB domain-containing protein 9) | EBI-27128638 | 0.35 |
| Q93008 | Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X) | EBI-27128638 | 0.35 |
| Q9HA64 | Ketosamine-3-kinase (EC 2.7.1.172) (Fructosamine-3-kinase-related protein) (FN3K-RP) (FN3K-related protein) (Protein-psicosamine 3-kinase FN3KRP) (EC 2.7.1.-) | EBI-27128638 | 0.35 |
| A3KMH1 | von Willebrand factor A domain-containing protein 8 (PEX7-binding protein 2) (P7BP2) | EBI-27128638 | 0.35 |
| Q9UKK9 | ADP-sugar pyrophosphatase (EC 3.6.1.13) (8-oxo-dGDP phosphatase) (EC 3.6.1.58) (Nuclear ATP-synthesis protein NUDIX5) (EC 2.7.7.96) (Nucleoside diphosphate-linked moiety X motif 5) (Nudix motif 5) (hNUDT5) (YSA1H) | EBI-27128638 | 0.35 |
| O95071 | E3 ubiquitin-protein ligase UBR5 (EC 2.3.2.26) (E3 ubiquitin-protein ligase, HECT domain-containing 1) (HECT-type E3 ubiquitin transferase UBR5) (Hyperplastic discs protein homolog) (hHYD) (Progestin-induced protein) | EBI-27128638 | 0.35 |
| Q7Z4H7 | HAUS augmin-like complex subunit 6 | EBI-27128638 | 0.35 |
| P78344 | Eukaryotic translation initiation factor 4 gamma 2 (eIF-4-gamma 2) (eIF-4G 2) (eIF4G 2) (Death-associated protein 5) (DAP-5) (p97) | EBI-27128638 | 0.35 |
| Q96CW1 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-30605858 | 0.40 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory