NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Solute carrier family 2, facilitated glucose transporter member 4 - Mus musculus - NucEnvDB

Solute carrier family 2, facilitated glucose transporter member 4 (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Solute carrier family 2, facilitated glucose transporter member 4
Accession Code	P14142
Gene	Slc2a4
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 509)
MPSGFQQIGSDDGEPPRQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATWLGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLAN AAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWPLLLALTVLPALLQLILLPFCPESPRYLYIIRNLEGPARKSLKRLTGWADVSDALAEL KDEKRKLERERPMSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFESAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFG FVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQISAAFRRTPSLLEQEVKPSTELEYLGPDEND

Subcellular Location

Description
Cell membrane {Experimental EvidencePubMed:21907143, Experimental EvidencePubMed:25586176, Experimental EvidencePubMed:26240143, Experimental EvidencePubMed:26629404, Experimental EvidencePubMed:27739494}; Multi-pass membrane protein {Experimental EvidencePubMed:21907143}. Endomembrane system {Experimental EvidencePubMed:26240143, Experimental EvidencePubMed:26629404}; Multi-pass membrane protein {ECO:0000305}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:26240143, Experimental EvidencePubMed:26629404, ECO:0000269\|PubMed:27354378}. Note=Localizes primarily to the perinuclear region, undergoing continued recycling to the plasma membrane where it is rapidly reinternalized (PubMed:26629404, PubMed:26240143, PubMed:27354378). The dileucine internalization motif is critical for intracellular sequestration (PubMed:26240143, PubMed:26629404). Insulin stimulation induces translocation to the cell membrane (PubMed:27739494). {Experimental EvidencePubMed:26240143, Experimental EvidencePubMed:26629404, ECO:0000269\|PubMed:27354378, Experimental EvidencePubMed:27739494}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Cell Surface (GO:0009986) Clathrin-Coated Pit (GO:0005905) Clathrin-Coated Vesicle (GO:0030136) Cytoplasm (GO:0005737) Cytoplasmic Vesicle Membrane (GO:0030659) Cytosol (GO:0005829) Endomembrane System (GO:0012505) Endosome (GO:0005768) External Side Of Plasma Membrane (GO:0009897) Extracellular Exosome (GO:0070062) Insulin-Responsive Compartment (GO:0032593) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Membrane Raft (GO:0045121) Multivesicular Body (GO:0005771) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Presynapse (GO:0098793) Sarcolemma (GO:0042383) Sarcoplasmic Reticulum (GO:0016529) T-Tubule (GO:0030315) Trans-Golgi Network (GO:0005802) Trans-Golgi Network Transport Vesicle (GO:0030140) Vesicle (GO:0031982) Vesicle Membrane (GO:0012506)

Biology & Function

Description
Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation (PubMed:26240143, PubMed:26629404). Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells (PubMed:26240143, PubMed:26629404). Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell (PubMed:26240143, PubMed:26629404). {Experimental EvidencePubMed:26240143, Experimental EvidencePubMed:26629404}.
Assigned Ontology terms

Biological Process	Amylopectin Biosynthetic Process (GO:0010021) Brown Fat Cell Differentiation (GO:0050873) Cellular Response To Hypoxia (GO:0071456) Cellular Response To Insulin Stimulus (GO:0032869) Cellular Response To Osmotic Stress (GO:0071470) Cellular Response To Tumor Necrosis Factor (GO:0071356) Glucose Homeostasis (GO:0042593) Glucose Import (GO:0046323) Glucose Import In Response To Insulin Stimulus (GO:0044381) Glucose Transmembrane Transport (GO:1904659) Learning Or Memory (GO:0007611) Long-Term Memory (GO:0007616) Monosaccharide Transmembrane Transport (GO:0015749) Positive Regulation Of Brain-Derived Neurotrophic Factor Receptor Signaling Pathway (GO:0031550) Regulation Of Synaptic Vesicle Budding From Presynaptic Endocytic Zone Membrane (GO:0098694) Response To Ethanol (GO:0045471) Short-Term Memory (GO:0007614)
Molecular Function	D-Glucose Transmembrane Transporter Activity (GO:0055056) Glucose Transmembrane Transporter Activity (GO:0005355) Glucose Uniporter Activity (GO:0015304) Hexose Transmembrane Transporter Activity (GO:0015149) Insulin-Responsive Glucose:Proton Symporter Activity (GO:0005360)

Disease associations

Description
Note=Defects in Slc2a4 may be the cause of certain post- receptor defects in non-insulin-dependent diabetes mellitus (NIDDM).
Database Associations
OMIM
DisGeNET

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
Q6P5E6	ADP-ribosylation factor-binding protein GGA2 (Gamma-adaptin-related protein 2) (Golgi-localized, gamma ear-containing, ARF-binding protein 2)	EBI-7540254	0.46
Q3U7R1	Extended synaptotagmin-1 (E-Syt1) (Membrane-bound C2 domain-containing protein)	EBI-15762008	0.50

Cross-References

Database	Links
UNIPROT	P14142 Q3TPK6 Q9JJN9
Pfam	PF00083
PROSITE	PS50850 PS00216 PS00217

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK