NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

B-cell lymphoma 3 protein - Homo sapiens - NucEnvDB

B-cell lymphoma 3 protein (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	B-cell lymphoma 3 protein
Accession Code	P20749
Gene	BCL3
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 454)
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPLRGGCDLPAVPGPPHGLARPE ALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHPLSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQ GGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRG LLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS SSPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS

Structure Viewer (PDB: 1K1A)

Subcellular Location

Description
Nucleus. Cytoplasm {By Similarity}. Cytoplasm, perinuclear region {By Similarity}. Note=Ubiquitination via 'Lys-63'- linked ubiquitin chains is required for nuclear accumulation. {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Bcl3-Bcl10 Complex (GO:0032996) Bcl3/NF-KappaB2 Complex (GO:0033257) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Intracellular Membrane-Bounded Organelle (GO:0043231) Midbody (GO:0030496) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Protein-Containing Complex (GO:0032991)

Biology & Function

Description
Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation (By similarity). {By Similarity, Experimental EvidencePubMed:8453667}.
Assigned Ontology terms

Biological Process	Antimicrobial Humoral Response (GO:0019730) Cellular Response To DNA Damage Stimulus (GO:0006974) Defense Response To Bacterium (GO:0042742) Defense Response To Protozoan (GO:0042832) DNA Damage Response, Signal Transduction By P53 Class Mediator (GO:0030330) Extracellular Matrix Organization (GO:0030198) Follicular Dendritic Cell Differentiation (GO:0002268) Germinal Center Formation (GO:0002467) Humoral Immune Response Mediated By Circulating Immunoglobulin (GO:0002455) I-KappaB Kinase/NF-KappaB Signaling (GO:0007249) Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage By P53 Class Mediator (GO:0042771) Marginal Zone B Cell Differentiation (GO:0002315) Negative Regulation Of Apoptotic Process (GO:0043066) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Negative Regulation Of Interleukin-8 Production (GO:0032717) Negative Regulation Of NF-KappaB Transcription Factor Activity (GO:0032088) Negative Regulation Of Receptor Signaling Pathway Via JAK-STAT (GO:0046426) Negative Regulation Of T Cell Apoptotic Process (GO:0070233) Negative Regulation Of Tumor Necrosis Factor Production (GO:0032720) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of Type II Interferon Production (GO:0032729) Positive Regulation Of Interleukin-10 Production (GO:0032733) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Positive Regulation Of Translation (GO:0045727) Protein Import Into Nucleus (GO:0006606) Regulation Of Apoptotic Process (GO:0042981) Regulation Of DNA Binding (GO:0051101) Regulation Of NIK/NF-KappaB Signaling (GO:1901222) Response To UV-C (GO:0010225) Response To Virus (GO:0009615) Spleen Development (GO:0048536) T Cell Apoptotic Process (GO:0070231) T-Helper 1 Type Immune Response (GO:0042088) T-Helper 2 Cell Differentiation (GO:0045064)
Molecular Function	DNA-Binding Transcription Factor Binding (GO:0140297) Histone Deacetylase Binding (GO:0042826) Protein-Macromolecule Adaptor Activity (GO:0030674) Transcription Coactivator Activity (GO:0003713) Transcription Corepressor Activity (GO:0003714)

Disease associations

Description
Note=A chromosomal aberration involving BCL3 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL). Translocation t(14;19)(q32;q13.1) with immunoglobulin gene regions. {Experimental EvidencePubMed:2180580, Experimental EvidencePubMed:7896265}.
Database Associations
OMIM	109560
DisGeNET	602

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9BVL2	Nucleoporin p58/p45	EBI-25907809	0.56
O95999	B-cell lymphoma/leukemia 10	EBI-959017	0.52
Interactions with other proteins (10 interactors)

Partner (UniProt)		IntAct	Confidence score
P06239	Tyrosine-protein kinase Lck (EC 2.7.10.2) (Leukocyte C-terminal Src kinase) (LSK) (Lymphocyte cell-specific protein-tyrosine kinase) (Protein YT16) (Proto-oncogene Lck) (T cell-specific protein-tyrosine kinase) (p56-LCK)	EBI-7785707	0.59
P06241	Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)	EBI-7785768	0.40
P56545	C-terminal-binding protein 2 (CtBP2)	EBI-3926425	0.51
O15084	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A (PP6-ARS-A) (Serine/threonine-protein phosphatase 6 regulatory subunit ARS-A) (Ankyrin repeat domain-containing protein 28) (Phosphatase interactor targeting protein hnRNP K) (PITK)	EBI-5653696	0.00
O00625	Pirin (EC 1.13.11.24) (Probable quercetin 2,3-dioxygenase PIR) (Probable quercetinase)	EBI-10713595	0.44
Q92598	Heat shock protein 105 kDa (Antigen NY-CO-25) (Heat shock 110 kDa protein)	EBI-21258808	0.35
Q00653	Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor KBF2) (H2TF1) (Lymphocyte translocation chromosome 10 protein) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2) (Oncogene Lyt-10) (Lyt10) [Cleaved into: Nuclear factor NF-kappa-B p52 subunit]	EBI-21258808	0.35
P19838	Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor KBF1) (EBP-1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) [Cleaved into: Nuclear factor NF-kappa-B p50 subunit]	EBI-21258808	0.35
P17066	Heat shock 70 kDa protein 6 (Heat shock 70 kDa protein B')	EBI-21258808	0.35
Q13619	Cullin-4A (CUL-4A)	EBI-30863570	0.35

Cross-References

Database	Links
UNIPROT	P20749
PDB	1K1A 1K1B
Pfam	PF12796
PROSITE	PS50297 PS50088
OMIM	109560
DisGeNET	602

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK