Protein Information |
|
|---|---|
| Protein Name | Nucleoporin p58/p45 |
| Accession Code | Q9BVL2 |
| Gene | NUP58 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 599) | |
|
MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGSKPATGFTLGG TNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTA TTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSK ALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELK NAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALA AQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGP QPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR |
|
Structure Viewer (PDB: 4JO9) |
|---|
Description |
||
|---|---|---|
| Nucleus, nuclear pore complex {By SimilarityUniProtKB:P70581}. Nucleus membrane {By SimilarityUniProtKB:P70581}; Peripheral membrane protein {By SimilarityUniProtKB:P70581}; Cytoplasmic side {By SimilarityUniProtKB:P70581}. Nucleus membrane {By SimilarityUniProtKB:P70581}; Peripheral membrane protein {By SimilarityUniProtKB:P70581}; Nucleoplasmic side {By SimilarityUniProtKB:P70581}. Note=Biased towards cytoplasmic side. Central region of the nuclear pore complex, within the transporter. {By SimilarityUniProtKB:P70581}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. |
| Nuclear Pore Complex | SL-0185 | The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs). | Membrane Topology |
| Topology | Source | Annotation Type |
| Peripheral | UniProt | By Similarity {ECO:0000250|UniProtKB:P70581} | Assigned Ontology terms |
| Cellular Component | Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) |
|
Description |
|
|---|---|
| Component of the nuclear pore complex, a complex required for the trafficking across the nuclear membrane. {By SimilarityUniProtKB:P70581}. | Assigned Ontology terms |
| Biological Process | MRNA Transport (GO:0051028) Nucleocytoplasmic Transport (GO:0006913) Protein Transport (GO:0015031) Regulation Of Protein Import Into Nucleus (GO:0042306) |
| Molecular Function | Identical Protein Binding (GO:0042802) Nuclear Localization Sequence Binding (GO:0008139) Protein-Containing Complex Binding (GO:0044877) Structural Constituent Of Nuclear Pore (GO:0017056) |
Interactions with Nuclear Envelope proteins (19 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P0DTD1 | 2'-O-methyltransferase nsp16 | EBI-25491191 | 0.53 |
| P37198 | Nuclear pore glycoprotein p62 | EBI-8635195 | 0.80 |
| P49792 | E3 SUMO-protein ligase RanBP2 | EBI-11077390 | 0.35 |
| P52948 | Nuclear pore complex protein Nup96 | EBI-11077390 | 0.35 |
| Q8N1F7 | Nuclear pore complex protein Nup93 | EBI-11077390 | 0.35 |
| Q99598 | Translin-associated protein X | EBI-25907995 | 0.56 |
| Q9BZF3 | Oxysterol-binding protein-related protein 6 | EBI-21639380 | 0.35 |
| P20749 | B-cell lymphoma 3 protein | EBI-25907809 | 0.56 |
| Q8WUX9 | Charged multivesicular body protein 7 | EBI-25908519 | 0.56 |
| A1KXE4 | Myelin-associated neurite-outgrowth inhibitor | EBI-25908575 | 0.56 |
| O14770 | Homeobox protein Meis2 | EBI-24450131 | 0.56 |
| Q9BTX1 | Nucleoporin NDC1 | EBI-11077390 | 0.35 |
| P57740 | Nuclear pore complex protein Nup107 | EBI-11077390 | 0.35 |
| Q5SRE5 | Nucleoporin NUP188 | EBI-11077390 | 0.35 |
| Q92621 | Nuclear pore complex protein Nup205 | EBI-11077390 | 0.35 |
| P35658 | Nuclear pore complex protein Nup214 | EBI-11077390 | 0.35 |
| Q8NFH5 | Nucleoporin NUP35 | EBI-11077390 | 0.35 |
| O15504 | Nucleoporin NUP42 | EBI-11077390 | 0.35 |
| Q7Z3B4 | Nucleoporin p54 | EBI-10299822 | 0.92 | Interactions with other proteins (129 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| A0A6L8PKS7 | Methyl-accepting chemotaxis protein | EBI-2811590 | 0.00 |
| P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | EBI-3437349 | 0.00 |
| Q9P2A4 | ABI gene family member 3 (New molecule including SH3) (Nesh) | EBI-8635212 | 0.78 |
| P27361 | Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (Microtubule-associated protein 2 kinase) (p44-ERK1) | EBI-7201994 | 0.37 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-6451221 | 0.74 |
| Q13077 | TNF receptor-associated factor 1 (Epstein-Barr virus-induced protein 6) | EBI-10299812 | 0.84 |
| Q9UMX0 | Ubiquilin-1 (Protein linking IAP with cytoskeleton 1) (PLIC-1) (hPLIC-1) | EBI-10299842 | 0.56 |
| Q99988 | Growth/differentiation factor 15 (GDF-15) (Macrophage inhibitory cytokine 1) (MIC-1) (NSAID-activated gene 1 protein) (NAG-1) (NSAID-regulated gene 1 protein) (NRG-1) (Placental TGF-beta) (Placental bone morphogenetic protein) (Prostate differentiation factor) | EBI-11077390 | 0.35 |
| Q969P6 | DNA topoisomerase I, mitochondrial (TOP1mt) (EC 5.6.2.1) | EBI-11077390 | 0.35 |
| Q9BSD7 | Cancer-related nucleoside-triphosphatase (NTPase) (EC 3.6.1.15) (Nucleoside triphosphate phosphohydrolase) | EBI-11077390 | 0.35 |
| P11532 | Dystrophin | EBI-11077390 | 0.35 |
| O15440 | ATP-binding cassette sub-family C member 5 (EC 7.6.2.-) (EC 7.6.2.2) (Multi-specific organic anion transporter C) (MOAT-C) (Multidrug resistance-associated protein 5) (SMRP) (pABC11) | EBI-11077390 | 0.35 |
| Q96A73 | Putative monooxygenase p33MONOX (EC 1.-.-.-) (Brain-derived rescue factor p60MONOX) (Flavin monooxygenase motif-containing protein of 33 kDa) | EBI-11077390 | 0.35 |
| Q96BD5 | PHD finger protein 21A (BHC80a) (BRAF35-HDAC complex protein BHC80) | EBI-11077390 | 0.35 |
| Q14746 | Conserved oligomeric Golgi complex subunit 2 (COG complex subunit 2) (Component of oligomeric Golgi complex 2) (Low density lipoprotein receptor defect C-complementing protein) | EBI-11077390 | 0.35 |
| Q9BPU9 | B9 domain-containing protein 2 (MKS1-related protein 2) | EBI-11377507 | 0.27 |
| Q96NL6 | Sodium channel and clathrin linker 1 (Sodium channel-associated protein 1) | EBI-11396361 | 0.27 |
| Q96JB2 | Conserved oligomeric Golgi complex subunit 3 (COG complex subunit 3) (Component of oligomeric Golgi complex 3) (Vesicle-docking protein SEC34 homolog) (p94) | EBI-24514268 | 0.72 |
| Q7Z3Y7 | Keratin, type I cytoskeletal 28 (Cytokeratin-28) (CK-28) (Keratin-25D) (K25D) (Keratin-28) (K28) (Type I inner root sheath-specific keratin-K25irs4) | EBI-24531449 | 0.56 |
| Q9NYP9 | Protein Mis18-alpha (FAPP1-associated protein 1) | EBI-24615263 | 0.72 |
| O95994 | Anterior gradient protein 2 homolog (AG-2) (hAG-2) (HPC8) (Secreted cement gland protein XAG-2 homolog) | EBI-24618865 | 0.56 |
| Q96KN3 | Homeobox protein PKNOX2 (Homeobox protein PREP-2) (PBX/knotted homeobox 2) | EBI-24406190 | 0.56 |
| Q9Y2V7 | Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6) | EBI-24474216 | 0.56 |
| Q7Z3Y8 | Keratin, type I cytoskeletal 27 (Cytokeratin-27) (CK-27) (Keratin-25C) (K25C) (Keratin-27) (K27) (Type I inner root sheath-specific keratin-K25irs3) | EBI-24474479 | 0.56 |
| Q9UHD9 | Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2) | EBI-24475280 | 0.56 |
| Q14525 | Keratin, type I cuticular Ha3-II (Hair keratin, type I Ha3-II) (Keratin-33B) (K33B) | EBI-24599138 | 0.72 |
| P55347 | Homeobox protein PKNOX1 (Homeobox protein PREP-1) (PBX/knotted homeobox 1) | EBI-24638583 | 0.72 |
| Q96P53 | WD repeat and FYVE domain-containing protein 2 (Propeller-FYVE protein) (Prof) (WD40- and FYVE domain-containing protein 2) (Zinc finger FYVE domain-containing protein 22) | EBI-21607501 | 0.35 |
| Q96A37 | E3 ubiquitin-protein ligase RNF166 (EC 2.3.2.27) (RING finger protein 166) (RING-type E3 ubiquitin transferase RNF166) | EBI-21627270 | 0.35 |
| Q5VX52 | Spermatogenesis-associated protein 1 (Sperm-specific protein SP-2) | EBI-21635815 | 0.35 |
| Q9NVF7 | F-box only protein 28 | EBI-21639380 | 0.35 |
| Q9HD26 | Golgi-associated PDZ and coiled-coil motif-containing protein (CFTR-associated ligand) (Fused in glioblastoma) (PDZ protein interacting specifically with TC10) (PIST) | EBI-21639380 | 0.35 |
| Q96AX9 | E3 ubiquitin-protein ligase MIB2 (EC 2.3.2.27) (Mind bomb homolog 2) (Novel zinc finger protein) (Novelzin) (Putative NF-kappa-B-activating protein 002N) (RING-type E3 ubiquitin transferase MIB2) (Skeletrophin) (Zinc finger ZZ type with ankyrin repeat domain protein 1) | EBI-21639380 | 0.35 |
| Q15075 | Early endosome antigen 1 (Endosome-associated protein p162) (Zinc finger FYVE domain-containing protein 2) | EBI-21639380 | 0.35 |
| O75150 | E3 ubiquitin-protein ligase BRE1B (BRE1-B) (EC 2.3.2.27) (95 kDa retinoblastoma-associated protein) (RBP95) (RING finger protein 40) (RING-type E3 ubiquitin transferase BRE1B) | EBI-21639380 | 0.35 |
| Q9H1M0 | Nucleoporin-62 C-terminal-like protein | EBI-21639380 | 0.35 |
| Q96FN4 | Copine-2 (Copine II) | EBI-21659658 | 0.35 |
| O75830 | Serpin I2 (Myoepithelium-derived serine protease inhibitor) (Pancpin) (Pancreas-specific protein TSA2004) (Peptidase inhibitor 14) (PI-14) | EBI-20916376 | 0.40 |
| Q9BYV2 | Tripartite motif-containing protein 54 (Muscle-specific RING finger protein) (MuRF) (Muscle-specific RING finger protein 3) (MuRF-3) (MuRF3) (RING finger protein 30) | EBI-22024904 | 0.00 |
| Q6P1K2 | Polyamine-modulated factor 1 (PMF-1) | EBI-25907819 | 0.56 |
| O75886 | Signal transducing adapter molecule 2 (STAM-2) (Hrs-binding protein) | EBI-25908093 | 0.56 |
| Q99996 | A-kinase anchor protein 9 (AKAP-9) (A-kinase anchor protein 350 kDa) (AKAP 350) (hgAKAP 350) (A-kinase anchor protein 450 kDa) (AKAP 450) (AKAP 120-like protein) (Centrosome- and Golgi-localized PKN-associated protein) (CG-NAP) (Protein hyperion) (Protein kinase A-anchoring protein 9) (PRKA9) (Protein yotiao) | EBI-25908085 | 0.56 |
| O60636 | Tetraspanin-2 (Tspan-2) (Tetraspan NET-3) | EBI-25908077 | 0.56 |
| Q14154 | DAP3-binding cell death enhancer 1 (DAP3-binding cell death enhancer 1, long form) (DELE1(L)) (Death ligand signal enhancer) [Cleaved into: DAP3-binding cell death enhancer 1 short form (DELE1(S)) (S-DELE1)] | EBI-25908069 | 0.56 |
| Q6ZU52 | Uncharacterized protein KIAA0408 | EBI-25908059 | 0.56 |
| A1A512 | KIAA0355 protein | EBI-25908051 | 0.56 |
| Q13503 | Mediator of RNA polymerase II transcription subunit 21 (Mediator complex subunit 21) (RNA polymerase II holoenzyme component SRB7) (RNAPII complex component SRB7) (hSrb7) | EBI-25908043 | 0.56 |
| Q52LW3 | Rho GTPase-activating protein 29 (PTPL1-associated RhoGAP protein 1) (Rho-type GTPase-activating protein 29) | EBI-25908035 | 0.56 |
| O00303 | Eukaryotic translation initiation factor 3 subunit F (eIF3f) (Deubiquitinating enzyme eIF3f) (EC 3.4.19.12) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47) | EBI-25908027 | 0.56 |
| Q92783 | Signal transducing adapter molecule 1 (STAM-1) | EBI-25908019 | 0.56 |
| Q8WUW1 | Protein BRICK1 (BRK1) | EBI-25908011 | 0.56 |
| P49459 | Ubiquitin-conjugating enzyme E2 A (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme A) (RAD6 homolog A) (HR6A) (hHR6A) (Ubiquitin carrier protein A) (Ubiquitin-protein ligase A) | EBI-25908003 | 0.56 |
| Q86WV8 | Hamartin (Tuberous sclerosis 1) | EBI-25907987 | 0.56 |
| Q14765 | Signal transducer and activator of transcription 4 | EBI-25907979 | 0.56 |
| Q96GM5 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (60 kDa BRG-1/Brm-associated factor subunit A) (BRG1-associated factor 60A) (BAF60A) (SWI/SNF complex 60 kDa subunit) | EBI-25907971 | 0.56 |
| P47804 | RPE-retinal G protein-coupled receptor | EBI-25907963 | 0.56 |
| P35998 | 26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2) | EBI-25907955 | 0.56 |
| Q9BR81 | Protocadherin gamma subfamily C, 3 (Protocadherin gamma-C3) | EBI-25907939 | 0.56 |
| Q13562 | Neurogenic differentiation factor 1 (NeuroD) (NeuroD1) (Class A basic helix-loop-helix protein 3) (bHLHa3) | EBI-25907931 | 0.56 |
| P02795 | Metallothionein-2 (MT-2) (Metallothionein-2A) (Metallothionein-II) (MT-II) | EBI-25907923 | 0.56 |
| P27338 | Amine oxidase [flavin-containing] B (EC 1.4.3.21) (EC 1.4.3.4) (Monoamine oxidase type B) (MAO-B) | EBI-25907915 | 0.56 |
| P80217 | Interferon-induced 35 kDa protein (IFP 35) (Ifi-35) | EBI-25907899 | 0.56 |
| Q06547 | GA-binding protein subunit beta-1 (GABP subunit beta-1) (GABPB-1) (GABP subunit beta-2) (GABPB-2) (Nuclear respiratory factor 2) (Transcription factor E4TF1-47) (Transcription factor E4TF1-53) | EBI-25907891 | 0.56 |
| O15287 | Fanconi anemia group G protein (Protein FACG) (DNA repair protein XRCC9) | EBI-25907875 | 0.56 |
| P41970 | ETS domain-containing protein Elk-3 (ETS-related protein ERP) (ETS-related protein NET) (Serum response factor accessory protein 2) (SAP-2) (SRF accessory protein 2) | EBI-25907867 | 0.56 |
| H3BUJ7 | Transcription factor E4F1 | EBI-25907859 | 0.56 |
| Q14117 | Dihydropyrimidinase (DHP) (DHPase) (EC 3.5.2.2) (Dihydropyrimidine amidohydrolase) (Hydantoinase) | EBI-25907851 | 0.56 |
| P24310 | Cytochrome c oxidase subunit 7A1, mitochondrial (Cytochrome c oxidase subunit VIIa-heart) (Cytochrome c oxidase subunit VIIa-H) (Cytochrome c oxidase subunit VIIa-muscle) (Cytochrome c oxidase subunit VIIa-M) | EBI-25907843 | 0.56 |
| Q86WV5 | CST complex subunit TEN1 (Protein telomeric pathways with STN1 homolog) (Telomere length regulation protein TEN1 homolog) | EBI-25907835 | 0.56 |
| Q13887 | Krueppel-like factor 5 (Basic transcription element-binding protein 2) (BTE-binding protein 2) (Colon krueppel-like factor) (GC-box-binding protein 2) (Intestinal-enriched krueppel-like factor) (Transcription factor BTEB2) | EBI-25907827 | 0.56 |
| Q9NP70 | Ameloblastin | EBI-25907801 | 0.56 |
| Q9BQS8 | FYVE and coiled-coil domain-containing protein 1 (Zinc finger FYVE domain-containing protein 7) | EBI-25908407 | 0.56 |
| O75934 | Pre-mRNA-splicing factor SPF27 (Breast carcinoma-amplified sequence 2) (DNA amplified in mammary carcinoma 1 protein) (Spliceosome-associated protein SPF 27) | EBI-25908101 | 0.56 |
| Q9BV99 | Leucine-rich repeat-containing protein 61 | EBI-25908389 | 0.56 |
| Q9BRX5 | DNA replication complex GINS protein PSF3 (GINS complex subunit 3) | EBI-25908381 | 0.56 |
| Q969X5 | Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ER-Golgi intermediate compartment 32 kDa protein) (ERGIC-32) | EBI-25908373 | 0.56 |
| Q6GQQ9 | OTU domain-containing protein 7B (EC 3.4.19.12) (Cellular zinc finger anti-NF-kappa-B protein) (Cezanne) (Zinc finger A20 domain-containing protein 1) (Zinc finger protein Cezanne) | EBI-25908363 | 0.56 |
| Q9NS71 | Gastrokine-1 (18 kDa antrum mucosa protein) (AMP-18) (Protein CA11) | EBI-25908355 | 0.56 |
| Q9BXU0 | Testis-expressed protein 12 | EBI-25908347 | 0.56 |
| Q96FT7 | Acid-sensing ion channel 4 (ASIC4) (Amiloride-sensitive cation channel 4) (Amiloride-sensitive cation channel 4, pituitary) | EBI-25908331 | 0.56 |
| Q96EP0 | E3 ubiquitin-protein ligase RNF31 (EC 2.3.2.31) (HOIL-1-interacting protein) (HOIP) (RING finger protein 31) (RING-type E3 ubiquitin transferase RNF31) (Zinc in-between-RING-finger ubiquitin-associated domain protein) | EBI-25908313 | 0.56 |
| Q96EN9 | Required for excision 1-B domain-containing protein | EBI-25908305 | 0.56 |
| Q6NXG1 | Epithelial splicing regulatory protein 1 (RNA-binding motif protein 35A) (RNA-binding protein 35A) | EBI-25908297 | 0.56 |
| Q9ULW8 | Protein-arginine deiminase type-3 (EC 3.5.3.15) (Peptidylarginine deiminase III) (Protein-arginine deiminase type III) | EBI-25908271 | 0.56 |
| Q8IXH7 | Negative elongation factor C/D (NELF-C/D) (TH1-like protein) | EBI-25908263 | 0.56 |
| P57682 | Krueppel-like factor 3 (Basic krueppel-like factor) (CACCC-box-binding protein BKLF) (TEF-2) | EBI-25908255 | 0.56 |
| Q9BPZ3 | Polyadenylate-binding protein-interacting protein 2 (PABP-interacting protein 2) (PAIP-2) (Poly(A)-binding protein-interacting protein 2) | EBI-25908247 | 0.56 |
| P57054 | Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (Down syndrome critical region protein 5) (Down syndrome critical region protein C) (Phosphatidylinositol-glycan biosynthesis class P protein) (PIG-P) | EBI-25908237 | 0.56 |
| Q9BT78 | COP9 signalosome complex subunit 4 (SGN4) (Signalosome subunit 4) (JAB1-containing signalosome subunit 4) | EBI-25908229 | 0.56 |
| Q9H347 | Ubiquilin-3 | EBI-25908221 | 0.56 |
| Q9BY12 | S phase cyclin A-associated protein in the endoplasmic reticulum (S phase cyclin A-associated protein in the ER) (Zinc finger protein 291) | EBI-25908211 | 0.56 |
| Q9NNX6 | CD209 antigen (C-type lectin domain family 4 member L) (Dendritic cell-specific ICAM-3-grabbing non-integrin 1) (DC-SIGN) (DC-SIGN1) (CD antigen CD209) | EBI-25908203 | 0.56 |
| Q8N490 | Probable hydrolase PNKD (EC 3.-.-.-) (Myofibrillogenesis regulator 1) (MR-1) (Paroxysmal nonkinesiogenic dyskinesia protein) (Trans-activated by hepatitis C virus core protein 2) | EBI-25908187 | 0.56 |
| Q6PID6 | Tetratricopeptide repeat protein 33 (TPR repeat protein 33) (Osmosis-responsive factor) | EBI-25908179 | 0.56 |
| Q13352 | Centromere protein R (CENP-R) (Beta-3-endonexin) (Integrin beta-3-binding protein) (Nuclear receptor-interacting factor 3) | EBI-25908169 | 0.56 |
| Q8TBE0 | Bromo adjacent homology domain-containing 1 protein (BAH domain-containing protein 1) | EBI-25908153 | 0.56 |
| O43482 | Protein Mis18-beta (Cancer/testis antigen 86) (CT86) (Opa-interacting protein 5) (OIP-5) | EBI-25908145 | 0.56 |
| O75935 | Dynactin subunit 3 (Dynactin complex subunit 22 kDa subunit) (p22) | EBI-25908137 | 0.56 |
| Q99871 | HAUS augmin-like complex subunit 7 (26S proteasome-associated UCH37-interacting protein 1) (UCHL5-interacting protein) (X-linked protein STS1769) | EBI-25908127 | 0.56 |
| O95229 | ZW10 interactor (ZW10-interacting protein 1) (Zwint-1) | EBI-25908119 | 0.56 |
| O75528 | Transcriptional adapter 3 (ADA3 homolog) (hADA3) (STAF54) (Transcriptional adapter 3-like) (ADA3-like protein) | EBI-25908109 | 0.56 |
| Q0VDD7 | Break repair meiotic recombinase recruitment factor 1 (Pre-T/NK cell-associated protein 3B3) | EBI-25908397 | 0.56 |
| Q86TI2 | Dipeptidyl peptidase 9 (DP9) (EC 3.4.14.5) (Dipeptidyl peptidase IV-related protein 2) (DPRP-2) (Dipeptidyl peptidase IX) (DPP IX) (Dipeptidyl peptidase-like protein 9) (DPLP9) | EBI-25908509 | 0.56 |
| Q8IY31 | Intraflagellar transport protein 20 homolog (hIFT20) | EBI-25908493 | 0.56 |
| Q8NE08 | COL25A1 protein | EBI-25908475 | 0.56 |
| Q86U90 | Threonylcarbamoyl-AMP synthase (EC 2.7.7.87) (Dopamine receptor-interacting protein 3) (Ischemia/reperfusion-inducible protein homolog) (hIRIP) | EBI-25908417 | 0.56 |
| Q9BV20 | Methylthioribose-1-phosphate isomerase (M1Pi) (MTR-1-P isomerase) (EC 5.3.1.23) (Mediator of RhoA-dependent invasion) (S-methyl-5-thioribose-1-phosphate isomerase) (Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein) | EBI-25908459 | 0.56 |
| Q8IUR5 | Protein O-mannosyl-transferase TMTC1 (EC 2.4.1.109) (Transmembrane and TPR repeat-containing protein 1) | EBI-25908451 | 0.56 |
| Q9H410 | Kinetochore-associated protein DSN1 homolog | EBI-25908435 | 0.56 |
| B7Z3E8 | cDNA FLJ51208 | EBI-25908427 | 0.56 |
| Q96MW5 | Conserved oligomeric Golgi complex subunit 8 (COG complex subunit 8) (Component of oligomeric Golgi complex 8) | EBI-25908467 | 0.56 |
| A1L190 | Synaptonemal complex central element protein 3 (Testis highly expressed gene 2 protein) (THEG-2) | EBI-25908655 | 0.56 |
| Q6DKI2 | Galectin-9C (Gal-9C) (Galectin-9-like protein B) | EBI-25908663 | 0.56 |
| Q7Z6I5 | Spermatogenesis-associated protein 12 (Spermatogenesis-related protein 5) | EBI-25908639 | 0.56 |
| Q8IWT0 | Protein archease (Protein ZBTB8OS) (Zinc finger and BTB domain-containing opposite strand protein 8) | EBI-25908631 | 0.56 |
| P58304 | Visual system homeobox 2 (Ceh-10 homeodomain-containing homolog) (Homeobox protein CHX10) | EBI-25908623 | 0.56 |
| Q8N6F8 | Methyltransferase-like protein 27 (Williams-Beuren syndrome chromosomal region 27 protein) | EBI-25908615 | 0.56 |
| Q6P597 | Kinesin light chain 3 (KLC2-like) (kinesin light chain 2) | EBI-25908607 | 0.56 |
| Q86WT6 | E3 ubiquitin-protein ligase TRIM69 (EC 2.3.2.27) (RFP-like domain-containing protein trimless) (RING finger protein 36) (RING-type E3 ubiquitin transferase TRIM69) (Tripartite motif-containing protein 69) | EBI-25908599 | 0.56 |
| Q96DX5 | Ankyrin repeat and SOCS box protein 9 (ASB-9) | EBI-25908591 | 0.56 |
| Q8NEZ2 | Vacuolar protein sorting-associated protein 37A (hVps37A) (ESCRT-I complex subunit VPS37A) (Hepatocellular carcinoma-related protein 1) | EBI-25908583 | 0.56 |
| Q8NDH6 | Islet cell autoantigen 1-like protein (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein) | EBI-25908567 | 0.56 |
| Q6ZMI0 | Protein phosphatase 1 regulatory subunit 21 (Coiled-coil domain-containing protein 128) (KLRAQ motif-containing protein 1) | EBI-25908559 | 0.56 |
| Q96A04 | TSSK6-activating co-chaperone protein (SSTK-interacting protein) (SIP) (SSTK-IP) | EBI-25908551 | 0.56 |
| Q96MN9 | Zinc finger protein 488 | EBI-25908543 | 0.56 |
| Q96CS2 | HAUS augmin-like complex subunit 1 (Coiled-coil domain-containing protein 5) (Enhancer of invasion-cluster) (HEI-C) | EBI-25908535 | 0.56 |
| Q9UII2 | ATPase inhibitor, mitochondrial (ATP synthase F1 subunit epsilon) (Inhibitor of F(1)F(o)-ATPase) (IF(1)) (IF1) | EBI-25908527 | 0.56 |
| Q8N4C7 | Syntaxin-19 | EBI-25908647 | 0.56 |
| Q93009 | Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) | EBI-30844216 | 0.44 |
Database | Links |
| UNIPROT | Q9BVL2 A6NI12 B4DZJ1 O43160 Q5JRG2 Q5JRG5 |
| PDB | 4JO7 4JO9 4JQ5 5IJN 5IJO 7PER |
| OMIM | 607615 |
| DisGeNET | 9818 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory