NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Stathmin-2 - Rattus norvegicus - NucEnvDB

Stathmin-2 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Stathmin-2
Accession Code	P21818
Gene	Stmn2
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 179)
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEGRRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKM AEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG

Subcellular Location

Description
Cytoplasm. Cytoplasm, perinuclear region. Cell projection, growth cone. Cell projection, axon. Membrane {Curator Inference}; Peripheral membrane protein {Curator Inference}; Cytoplasmic side {Curator Inference}. Golgi apparatus. Endosome. Cell projection, lamellipodium {ECO:0000250}. Note=Colocalized with CIB1 in the cell body, neuritis and growth cones of neurons. Colocalized with CIB1 to the leading edge of lamellipodia (By similarity). Associated with punctate structures in the perinuclear cytoplasm, axons, and growth cones of developing neurons. Exists in both soluble and membrane-bound forms. Colocalized with CIB1 in neurites of developing hippocampal primary neurons. {ECO:0000250}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Endosome (GO:0005768) Golgi Apparatus (GO:0005794) Growth Cone (GO:0030426) Lamellipodium (GO:0030027) Membrane (GO:0016020) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471) Vesicle (GO:0031982)

Biology & Function

Description
Regulator of microtubule stability. When phosphorylated by MAPK8, stabilizes microtubules and consequently controls neurite length in cortical neurons. In the developing brain, negatively regulates the rate of exit from multipolar stage and retards radial migration from the ventricular zone. {Experimental EvidencePubMed:16618812, Experimental EvidencePubMed:21297631, Experimental EvidencePubMed:9012855}.
Assigned Ontology terms

Biological Process	Cellular Response To Nerve Growth Factor Stimulus (GO:1990090) Microtubule Depolymerization (GO:0007019) Negative Regulation Of Microtubule Depolymerization (GO:0007026) Negative Regulation Of Microtubule Polymerization (GO:0031115) Negative Regulation Of Neuron Projection Development (GO:0010977) Neuron Projection Development (GO:0031175) Positive Regulation Of Microtubule Depolymerization (GO:0031117) Positive Regulation Of Neuron Projection Development (GO:0010976) Regulation Of Microtubule Polymerization Or Depolymerization (GO:0031110)
Molecular Function	Calcium-Dependent Protein Binding (GO:0048306) Tubulin Binding (GO:0015631)

Cross-References

Database	Links
UNIPROT	P21818 Q9ERH2
Pfam	PF00836
PROSITE	PS00563 PS01041 PS51663

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK