Protein Information |
|
---|---|
Protein Name | Nucleoside diphosphate kinase B |
Accession Code | P22392 |
Gene | NME2 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 152) | |
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEG LNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
Structure Viewer (PDB: 3BBC) |
---|
Description |
||
---|---|---|
Cytoplasm {Experimental EvidencePubMed:17532299}. Cell projection, lamellipodium {Experimental EvidencePubMed:11919189}. Cell projection, ruffle {Experimental EvidencePubMed:11919189}. Note=Colocalizes with ITGB1 and ITGB1BP1 at the edge or peripheral ruffles and lamellipodia during the early stages of cell spreading on fibronectin or collagen but not on vitronectin or laminin substrates. {Experimental EvidencePubMed:11919189}. [Isoform 1]: Cytoplasm {ECO:0000269|PubMed:16442775}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:16442775}. Nucleus {ECO:0000269|PubMed:16442775}. [Isoform 3]: Cytoplasm {ECO:0000269|PubMed:16442775}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:16442775}. Nucleus {ECO:0000269|PubMed:16442775}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
Cellular Component | Cell Periphery (GO:0071944) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Extracellular Region (GO:0005576) Ficolin-1-Rich Granule Lumen (GO:1904813) Lamellipodium (GO:0030027) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Ruffle (GO:0001726) Secretory Granule Lumen (GO:0034774) |
Description |
|
---|---|
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC (PubMed:15249197). Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed:8392752, PubMed:19435876). Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1) (PubMed:19435876). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not (PubMed:25679041). Exhibits histidine protein kinase activity (PubMed:20946858). {By SimilarityUniProtKB:P36010, Experimental EvidencePubMed:15249197, Experimental EvidencePubMed:19435876, Experimental EvidencePubMed:20946858, Experimental EvidencePubMed:25679041, Experimental EvidencePubMed:8392752}. | Assigned Ontology terms |
Biological Process | Cell Adhesion (GO:0007155) CTP Biosynthetic Process (GO:0006241) GTP Biosynthetic Process (GO:0006183) Integrin-Mediated Signaling Pathway (GO:0007229) Negative Regulation Of Apoptotic Process (GO:0043066) Nucleoside Diphosphate Phosphorylation (GO:0006165) Nucleoside Triphosphate Biosynthetic Process (GO:0009142) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of Epithelial Cell Proliferation (GO:0050679) Positive Regulation Of Keratinocyte Differentiation (GO:0045618) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Regulation Of Apoptotic Process (GO:0042981) Regulation Of Epidermis Development (GO:0045682) UTP Biosynthetic Process (GO:0006228) |
Molecular Function | ATP Binding (GO:0005524) DNA Binding (GO:0003677) G-Quadruplex DNA Binding (GO:0051880) GDP Binding (GO:0019003) Metal Ion Binding (GO:0046872) Nucleoside Diphosphate Kinase Activity (GO:0004550) Protein Histidine Kinase Activity (GO:0004673) Transcription Coactivator Activity (GO:0003713) |
Interactions with Nuclear Envelope proteins (2 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
P22392 | Self | EBI-3943380 | 0.37 |
Q00613 | Heat shock factor protein 1 | EBI-9394221 | 0.35 | Interactions with other proteins (95 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q13232 | Nucleoside diphosphate kinase 3 (NDK 3) (NDP kinase 3) (EC 2.7.4.6) (DR-nm23) (Nucleoside diphosphate kinase C) (NDPKC) (nm23-H3) | EBI-21647179 | 0.35 |
Q15435 | Protein phosphatase 1 regulatory subunit 7 (Protein phosphatase 1 regulatory subunit 22) | EBI-1059661 | 0.00 |
P01615 | Immunoglobulin kappa variable 2D-28 (Ig kappa chain V-II region FR) (Ig kappa chain V-II region GM607) (Ig kappa chain V-II region MIL) (Ig kappa chain V-II region TEW) | EBI-1061143 | 0.00 |
P28222 | 5-hydroxytryptamine receptor 1B (5-HT-1B) (5-HT1B) (S12) (Serotonin 1D beta receptor) (5-HT-1D-beta) (Serotonin receptor 1B) | EBI-1061406 | 0.00 |
Q12972 | Nuclear inhibitor of protein phosphatase 1 (NIPP-1) (Protein phosphatase 1 regulatory inhibitor subunit 8) [Includes: Activator of RNA decay (EC 3.1.4.-) (ARD-1)] | EBI-1064323 | 0.00 |
P52434 | DNA-directed RNA polymerases I, II, and III subunit RPABC3 (RNA polymerases I, II, and III subunit ABC3) (DNA-directed RNA polymerase II subunit H) (DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide) (RPB17) (RPB8 homolog) (hRPB8) | EBI-1071336 | 0.00 |
P62807 | Histone H2B type 1-C/E/F/G/I (Histone H2B.1 A) (Histone H2B.a) (H2B/a) (Histone H2B.g) (H2B/g) (Histone H2B.h) (H2B/h) (Histone H2B.k) (H2B/k) (Histone H2B.l) (H2B/l) | EBI-1075233 | 0.00 |
Q9HB71 | Calcyclin-binding protein (CacyBP) (hCacyBP) (S100A6-binding protein) (Siah-interacting protein) | EBI-1075281 | 0.00 |
O00264 | Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA) | EBI-1075521 | 0.00 |
P63173 | 60S ribosomal protein L38 (Large ribosomal subunit protein eL38) | EBI-1075834 | 0.00 |
P54819 | Adenylate kinase 2, mitochondrial (AK 2) (EC 2.7.4.3) (ATP-AMP transphosphorylase 2) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) [Cleaved into: Adenylate kinase 2, mitochondrial, N-terminally processed] | EBI-1076537 | 0.00 |
P61088 | Ubiquitin-conjugating enzyme E2 N (EC 2.3.2.23) (Bendless-like ubiquitin-conjugating enzyme) (E2 ubiquitin-conjugating enzyme N) (Ubc13) (UbcH13) (Ubiquitin carrier protein N) (Ubiquitin-protein ligase N) | EBI-1076851 | 0.00 |
Q9NPH2 | Inositol-3-phosphate synthase 1 (IPS 1) (EC 5.5.1.4) (Myo-inositol 1-phosphate synthase) (MI-1-P synthase) (MIP synthase) (hIPS) (Myo-inositol 1-phosphate synthase A1) (hINO1) | EBI-1076944 | 0.00 |
Q13283 | Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) | EBI-1076964 | 0.00 |
Q01105 | Protein SET (HLA-DR-associated protein II) (Inhibitor of granzyme A-activated DNase) (IGAAD) (PHAPII) (Phosphatase 2A inhibitor I2PP2A) (I-2PP2A) (Template-activating factor I) (TAF-I) | EBI-1077547 | 0.00 |
P25787 | Proteasome subunit alpha type-2 (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) (Proteasome component C3) | EBI-1077873 | 0.00 |
Q9Y3F4 | Serine-threonine kinase receptor-associated protein (MAP activator with WD repeats) (UNR-interacting protein) (WD-40 repeat protein PT-WD) | EBI-1077889 | 0.00 |
P61086 | Ubiquitin-conjugating enzyme E2 K (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme K) (Huntingtin-interacting protein 2) (HIP-2) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-25 kDa) (Ubiquitin-conjugating enzyme E2(25K)) (Ubiquitin-conjugating enzyme E2-25K) (Ubiquitin-protein ligase) | EBI-1077953 | 0.00 |
P16152 | Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.196, EC 1.1.1.197) (20-beta-hydroxysteroid dehydrogenase) (Alcohol dehydrogenase [NAD(P)+] CBR1) (EC 1.1.1.71) (NADPH-dependent carbonyl reductase 1) (Prostaglandin 9-ketoreductase) (PG-9-KR) (Prostaglandin-E(2) 9-reductase) (EC 1.1.1.189) (Short chain dehydrogenase/reductase family 21C member 1) | EBI-1078617 | 0.00 |
P61626 | Lysozyme C (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) | EBI-1078976 | 0.00 |
P39019 | 40S ribosomal protein S19 (Small ribosomal subunit protein eS19) | EBI-1078996 | 0.00 |
Q15084 | Protein disulfide-isomerase A6 (EC 5.3.4.1) (Endoplasmic reticulum protein 5) (ER protein 5) (ERp5) (Protein disulfide isomerase P5) (Thioredoxin domain-containing protein 7) | EBI-1079212 | 0.00 |
P62249 | 40S ribosomal protein S16 (Small ribosomal subunit protein uS9) | EBI-1079501 | 0.00 |
O00232 | 26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit RPN5) (26S proteasome regulatory subunit p55) | EBI-1079589 | 0.00 |
P05455 | Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B) | EBI-1080231 | 0.00 |
Q9NQC3 | Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) | EBI-1080716 | 0.00 |
P30153 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Medium tumor antigen-associated 61 kDa protein) (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha) | EBI-1080986 | 0.00 |
Q15365 | Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1) (Nucleic acid-binding protein SUB2.3) | EBI-1081301 | 0.00 |
P04844 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit) (RIBIIR) (Ribophorin II) (RPN-II) (Ribophorin-2) | EBI-1082016 | 0.00 |
P58107 | Epiplakin (450 kDa epidermal antigen) | EBI-1082068 | 0.00 |
P53396 | ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate (pro-S-)-lyase) (ACL) (Citrate cleavage enzyme) | EBI-1082405 | 0.00 |
O60518 | Ran-binding protein 6 (RanBP6) | EBI-1082514 | 0.00 |
Q9Y333 | U6 snRNA-associated Sm-like protein LSm2 (Protein G7b) (Small nuclear ribonuclear protein D homolog) (snRNP core Sm-like protein Sm-x5) | EBI-1082666 | 0.00 |
P61326 | Protein mago nashi homolog | EBI-1082762 | 0.00 |
Q9Y2L1 | Exosome complex exonuclease RRP44 (EC 3.1.13.-) (EC 3.1.26.-) (Protein DIS3 homolog) (Ribosomal RNA-processing protein 44) | EBI-1083038 | 0.00 |
P31948 | Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521) | EBI-1083082 | 0.00 |
Q6FHQ0 | RBBP7 protein (Retinoblastoma binding protein 7) (Retinoblastoma binding protein 7, isoform CRA_a) | EBI-1083767 | 0.00 |
P54725 | UV excision repair protein RAD23 homolog A (HR23A) (hHR23A) | EBI-1084508 | 0.00 |
O14818 | Proteasome subunit alpha type-7 (Proteasome subunit RC6-1) (Proteasome subunit XAPC7) | EBI-1084536 | 0.00 |
P50502 | Hsc70-interacting protein (Hip) (Aging-associated protein 2) (Progesterone receptor-associated p48 protein) (Protein FAM10A1) (Putative tumor suppressor ST13) (Renal carcinoma antigen NY-REN-33) (Suppression of tumorigenicity 13 protein) | EBI-1084657 | 0.00 |
P68402 | Platelet-activating factor acetylhydrolase IB subunit alpha2 (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH subunit beta) (PAFAH subunit beta) | EBI-1084933 | 0.00 |
Q14204 | Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic) | EBI-1085083 | 0.00 |
P28070 | Proteasome subunit beta type-4 (26 kDa prosomal protein) (HsBPROS26) (PROS-26) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome beta chain) (Proteasome chain 3) (HsN3) | EBI-1085900 | 0.00 |
Q9NZ23 | Drug-sensitive protein 1 (Gastric-associated differentially-expressed protein YA61P) | EBI-1085916 | 0.00 |
Q9Y230 | RuvB-like 2 (EC 3.6.4.12) (48 kDa TATA box-binding protein-interacting protein) (48 kDa TBP-interacting protein) (51 kDa erythrocyte cytosolic protein) (ECP-51) (INO80 complex subunit J) (Repressing pontin 52) (Reptin 52) (TIP49b) (TIP60-associated protein 54-beta) (TAP54-beta) | EBI-1086002 | 0.00 |
Q7L2H7 | Eukaryotic translation initiation factor 3 subunit M (eIF3m) (Fetal lung protein B5) (hFL-B5) (PCI domain-containing protein 1) | EBI-1086018 | 0.00 |
P31939 | Bifunctional purine biosynthesis protein ATIC (AICAR transformylase/inosine monophosphate cyclohydrolase) (ATIC) [Cleaved into: Bifunctional purine biosynthesis protein ATIC, N-terminally processed] [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) (AICAR formyltransferase) (AICAR transformylase); Inosine 5'-monophosphate cyclohydrolase (IMP cyclohydrolase) (EC 3.5.4.10) (IMP synthase) (Inosinicase)] | EBI-1086191 | 0.00 |
P33176 | Kinesin-1 heavy chain (Conventional kinesin heavy chain) (Ubiquitous kinesin heavy chain) (UKHC) | EBI-1086252 | 0.00 |
P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-7192531 | 0.40 |
Q00005 | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PP2A subunit B isoform B55-beta) (PP2A subunit B isoform PR55-beta) (PP2A subunit B isoform R2-beta) (PP2A subunit B isoform beta) | EBI-2210942 | 0.35 |
O14713 | Integrin beta-1-binding protein 1 (Integrin cytoplasmic domain-associated protein 1) (ICAP-1) | EBI-2127350 | 0.67 |
P15531 | Nucleoside diphosphate kinase A (NDK A) (NDP kinase A) (EC 2.7.4.6) (Granzyme A-activated DNase) (GAAD) (Metastasis inhibition factor nm23) (NM23-H1) (Tumor metastatic process-associated protein) | EBI-2127719 | 0.68 |
P62745 | Rho-related GTP-binding protein RhoB (Rho cDNA clone 6) (h6) | EBI-2505928 | 0.37 |
P68372 | Tubulin beta-4B chain (Tubulin beta-2C chain) | EBI-2562208 | 0.40 |
O46385 | Supervillin (Archvillin) (p205/p250) | EBI-7872718 | 0.37 |
A0A380PGZ4 | Putative exported protein | EBI-2863406 | 0.00 |
Q8ZJJ5 | ATP-dependent protease ATPase subunit HslU (Unfoldase HslU) | EBI-2863413 | 0.00 |
Q13363 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) | EBI-3907897 | 0.37 |
P20339 | Ras-related protein Rab-5A (EC 3.6.5.2) | EBI-3911907 | 0.37 |
Q14161 | ARF GTPase-activating protein GIT2 (ARF GAP GIT2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT-2) (CAT2) (G protein-coupled receptor kinase-interactor 2) (GRK-interacting protein 2) | EBI-3932667 | 0.37 |
O00746 | Nucleoside diphosphate kinase, mitochondrial (NDK) (NDP kinase, mitochondrial) (EC 2.7.4.6) (Nucleoside diphosphate kinase D) (NDPKD) (nm23-H4) | EBI-3932657 | 0.55 |
Q7Z465 | Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein | EBI-3942659 | 0.37 |
Q8IZL9 | Cyclin-dependent kinase 20 (EC 2.7.11.22) (CDK-activating kinase p42) (CAK-kinase p42) (Cell cycle-related kinase) (Cell division protein kinase 20) (Cyclin-dependent protein kinase H) (Cyclin-kinase-activating kinase p42) | EBI-6381092 | 0.35 |
Q9Y2J4 | Angiomotin-like protein 2 (Leman coiled-coil protein) (LCCP) | EBI-8797381 | 0.35 |
Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770198 | 0.35 |
Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-11897791 | 0.35 |
Q8NI37 | Protein phosphatase PTC7 homolog (EC 3.1.3.16) (T-cell activation protein phosphatase 2C) (TA-PP2C) (T-cell activation protein phosphatase 2C-like) | EBI-14026943 | 0.35 |
Q8TCT1 | Phosphoethanolamine/phosphocholine phosphatase (EC 3.1.3.75) | EBI-14027014 | 0.35 |
Q9H3S7 | Tyrosine-protein phosphatase non-receptor type 23 (EC 3.1.3.48) (His domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) | EBI-14027652 | 0.35 |
Q76RH1 | Cytoplasmic envelopment protein 1 | EBI-14063481 | 0.40 |
P50570 | Dynamin-2 (EC 3.6.5.5) | EBI-16110780 | 0.52 |
P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-16799122 | 0.35 |
Q96HJ9 | Protein FMC1 homolog (ATP synthase assembly factor FMC1, mitochondrial) (Formation of mitochondrial complex V assembly factor 1 homolog) | EBI-21929593 | 0.35 |
O00483 | Cytochrome c oxidase subunit NDUFA4 (Complex I-MLRQ) (CI-MLRQ) (NADH-ubiquinone oxidoreductase MLRQ subunit) | EBI-21930681 | 0.35 |
O75489 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial (EC 7.1.1.2) (Complex I-30kD) (CI-30kD) (NADH-ubiquinone oxidoreductase 30 kDa subunit) | EBI-21931040 | 0.35 |
Q96FC7 | Phytanoyl-CoA hydroxylase-interacting protein-like | EBI-21931532 | 0.35 |
Q8N3J5 | Protein phosphatase 1K, mitochondrial (EC 3.1.3.16) (PP2C domain-containing protein phosphatase 1K) (PP2C-like mitochondrial protein) (PP2C-type mitochondrial phosphoprotein phosphatase) (PTMP) (Protein phosphatase 2C isoform kappa) (PP2C-kappa) | EBI-21931555 | 0.35 |
Q9H6K4 | Optic atrophy 3 protein | EBI-21931410 | 0.35 |
Q9Y3B1 | PRELI domain containing protein 3B (Protein slowmo homolog 2) | EBI-21931754 | 0.35 |
O60260 | E3 ubiquitin-protein ligase parkin (Parkin) (EC 2.3.2.31) (Parkin RBR E3 ubiquitin-protein ligase) (Parkinson juvenile disease protein 2) (Parkinson disease protein 2) | EBI-21135687 | 0.35 |
P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
Q32Q12 | Nucleoside diphosphate kinase (EC 2.7.4.6) | EBI-25382283 | 0.35 |
Q8N264 | Rho GTPase-activating protein 24 (Filamin-A-associated RhoGAP) (FilGAP) (RAC1- and CDC42-specific GTPase-activating protein of 72 kDa) (RC-GAP72) (Rho-type GTPase-activating protein 24) (RhoGAP of 73 kDa) (Sarcoma antigen NY-SAR-88) (p73RhoGAP) | EBI-25408352 | 0.35 |
Q9NRY4 | Rho GTPase-activating protein 35 (Glucocorticoid receptor DNA-binding factor 1) (Glucocorticoid receptor repression factor 1) (GRF-1) (Rho GAP p190A) (p190-A) | EBI-25408519 | 0.35 |
Q8NF50 | Dedicator of cytokinesis protein 8 | EBI-25409278 | 0.35 |
Q8K337 | Type II inositol 1,4,5-trisphosphate 5-phosphatase (EC 3.1.3.36) (Inositol polyphosphate-5-phosphatase B) (Phosphoinositide 5-phosphatase) (5PTase) | EBI-25409748 | 0.35 |
Q8TCU6 | Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (P-Rex1) (PtdIns(3,4,5)-dependent Rac exchanger 1) | EBI-25411141 | 0.35 |
Q9H3R0 | Lysine-specific demethylase 4C (EC 1.14.11.66) (Gene amplified in squamous cell carcinoma 1 protein) (GASC-1 protein) (JmjC domain-containing histone demethylation protein 3C) (Jumonji domain-containing protein 2C) ([histone H3]-trimethyl-L-lysine(9) demethylase 4C) | EBI-25479978 | 0.35 |
P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-26510919 | 0.37 |
O60303 | Katanin-interacting protein | EBI-26582514 | 0.35 |
P36507 | Dual specificity mitogen-activated protein kinase kinase 2 (MAP kinase kinase 2) (MAPKK 2) (EC 2.7.12.2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK 2) | EBI-28935019 | 0.35 |
P0DTC9 | Nucleoprotein (N) (Nucleocapsid protein) (NC) (Protein N) | EBI-28955760 | 0.35 |
Q9BXK1 | Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2) | EBI-29019783 | 0.35 |
Q05DH4 | FHF complex subunit HOOK interacting protein 1A (FHIP1A) (FTS and Hook-interacting protein like) (FHIP-L) | EBI-34574576 | 0.27 |
Q5W0V3 | FHF complex subunit HOOK interacting protein 2A (FHIP2A) | EBI-34574999 | 0.27 |
Database | Links |
UNIPROT | P22392 A8MWA3 Q1WM23 Q6LCT6 |
PDB | 1NSK 1NUE 3BBB 3BBC 3BBF 7KPF |
Pfam | PF00334 |
PROSITE | PS00469 |
OMIM | 156491 |
DisGeNET | 4831 654364 |