Nucleoporin NUP2 - Saccharomyces cerevisiae S288C

Nucleoporin NUP2 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nucleoporin NUP2
Accession Code	P32499
Gene	NUP2
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 720)
MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAFKPFGSAKSDETKQASSFSFLNRADGTGEAQ VDNSPTTESNSRLKALNLQFKAKVDDLVLGKPLADLRPLFTRYELYIKNILEAPVKSIENPTQTKGNDAKPAKVEDVQKS SDSSSEDEVKVEGPKFTIDAKPPISDSVFSFGPKKENRKKDESDSENDIEIKGPEFKFSGTVSSDVFKLNPSTDKNEKKT ETNAKPFSFSSATSTTEQTKSKNPLSLTEATKTNVDNNSKAEASFTFGTKHAADSQNNKPSFVFGQAAAKPSLEKSSFTF GSTTIEKKNDENSTSNSKPEKSSDSNDSNPSFSFSIPSKNTPDASKPSFSFGVPNSSKNETSKPVFSFGAATPSAKEASQ EDDNNNVEKPSSKPAFNLISNAGTEKEKESKKDSKPAFSFGISNGSESKDSDKPSLPSAVDGENDKKEATKPAFSFGINT NTTKTADTKAPTFTFGSSALADNKEDVKKPFSFGTSQPNNTPSFSFGKTTANLPANSSTSPAPSIPSTGFKFSLPFEQKG SQTTTNDSKEESTTEATGNESQDATKVDATPEESKPINLQNGEEDEVALFSQKAKLMTFNAETKSYDSRGVGEMKLLKKK DDPSKVRLLCRSDGMGNVLLNATVVDSFKYEPLAPGNDNLIKAPTVAADGKLVTYIVKFKQKEEGRSFTKAIEDAKKEMK

Structure Viewer (PDB: 2C1T)

Subcellular Location

Description
Nucleus, nuclear pore complex {Experimental EvidencePubMed:10684247}. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Chromosome, Telomeric Region (GO:0000781) Cytoplasm (GO:0005737) Mitochondrion (GO:0005739) NLS-Dependent Protein Nuclear Import Complex (GO:0042564) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nuclear Pore Cytoplasmic Filaments (GO:0044614) Nuclear Pore Nuclear Basket (GO:0044615)

Biology & Function

Description
Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured by both, a Phe-Gly (FG) repeat affinity gradient for these transport factors across the NPC and a transport cofactor concentration gradient across the nuclear envelope (GSP1 and GSP2 GTPases associated predominantly with GTP in the nucleus, with GDP in the cytoplasm). As one of the FG repeat nucleoporins NUP2 is involved in interactions with and guidance of nuclear transport receptors such as SRP1-KAP95 (importin alpha and beta) through the NPC. Like the closely related NUP1 it also plays an important role in disassembling and recycling SRP1-KAP95 to the cytoplasm after nuclear import. Upon entry of the heterotrimeric SRP1- KAP95-cargo complex in the nucleus, NUP2 binds through its N-terminus to the SRP1 nuclear localization signal (NLS) binding site, thus accelerating the release of the NLS-cargo. SRP1 in turn is released from NUP2 by binding of the GSP1-GTP associated export factor CSE1. NUP2 may also have a chromatin boundary/insulator activity through indirect interaction with genomic DNA via CSE1 and blocking of heterochromatin spreading. {Experimental EvidencePubMed:10684247, Experimental EvidencePubMed:11046143, Experimental EvidencePubMed:11387327, Experimental EvidencePubMed:11425876, Experimental EvidencePubMed:11535617, Experimental EvidencePubMed:11867631, Experimental EvidencePubMed:12062099, Experimental EvidencePubMed:12372823, Experimental EvidencePubMed:12543930, Experimental EvidencePubMed:12604785, Experimental EvidencePubMed:12917401, Experimental EvidencePubMed:14514698, Experimental EvidencePubMed:15039779}.
Assigned Ontology terms

Biological Process	MRNA Export From Nucleus In Response To Heat Stress (GO:0031990) NLS-Bearing Protein Import Into Nucleus (GO:0006607) Nucleocytoplasmic Transport (GO:0006913) Poly(A)+ MRNA Export From Nucleus (GO:0016973) Post-Transcriptional Tethering Of RNA Polymerase II Gene DNA At Nuclear Periphery (GO:0000973) Protein Export From Nucleus (GO:0006611) Protein Localization To Nuclear Inner Membrane (GO:0036228) Regulation Of Catalytic Activity (GO:0050790) Silent Mating-Type Cassette Heterochromatin Formation (GO:0030466) Subtelomeric Heterochromatin Formation (GO:0031509) Transcription-Dependent Tethering Of RNA Polymerase II Gene DNA At Nuclear Periphery (GO:0000972)
Molecular Function	Importin-Alpha Family Protein Binding (GO:0061676) Small GTPase Binding (GO:0031267) Structural Constituent Of Nuclear Pore (GO:0017056)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (13 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P39705	Nucleoporin NUP60	EBI-801825	0.70
P32499	Self	EBI-1270044	0.00
P46673	Nucleoporin NUP85	EBI-1270055	0.00
P48837	Nucleoporin NUP57	EBI-6322523	0.00
Q02199	Nucleoporin NUP49/NSP49	EBI-6322534	0.00
Q02821	Importin subunit alpha	EBI-801825	0.78
Q06142	Importin subunit beta-1	EBI-784458	0.78
P40069	Importin subunit beta-4	EBI-801825	0.35
P40358	DnaJ-like chaperone JEM1	EBI-3657516	0.35
P34077	Nucleoporin NIC96	EBI-6322501	0.00
P14907	Nucleoporin NSP1	EBI-6322490	0.00
P38181	Nucleoporin NUP170	EBI-1270066	0.00
P47054	Nucleoporin NUP192	EBI-6322512	0.00
Interactions with other proteins (33 interactors)

Partner (UniProt)		IntAct	Confidence score
P38910	10 kDa heat shock protein, mitochondrial (HSP10) (10 kDa chaperonin)	EBI-390864	0.37
P32799	Cytochrome c oxidase subunit 13, mitochondrial (Cytochrome c oxidase polypeptide VIa)	EBI-792386	0.35
P53833	Ribonucleases P/MRP protein subunit POP3 (RNA-processing protein POP3) (RNases MRP/P 22.6 kDa subunit)	EBI-799459	0.35
P16140	V-type proton ATPase subunit B (V-ATPase subunit B) (V-ATPase 57 kDa subunit) (Vacuolar proton pump subunit B)	EBI-801825	0.35
P09734	Tubulin alpha-3 chain (EC 3.6.5.-)	EBI-801825	0.35
P02557	Tubulin beta chain (Beta-tubulin)	EBI-801825	0.35
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-801825	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-801825	0.53
P10592	Heat shock protein SSA2	EBI-801825	0.53
P10659	S-adenosylmethionine synthase 1 (AdoMet synthase 1) (EC 2.5.1.6) (Methionine adenosyltransferase 1) (MAT 1)	EBI-801825	0.35
P00549	Pyruvate kinase 1 (PK 1) (EC 2.7.1.40) (cell division cycle protein 19)	EBI-801825	0.35
P00830	ATP synthase subunit beta, mitochondrial (EC 7.1.2.2)	EBI-801825	0.35
P00330	Alcohol dehydrogenase 1 (EC 1.1.1.1) (Alcohol dehydrogenase I) (YADH-1)	EBI-801825	0.35
P28003	SWIRM domain-containing protein FUN19	EBI-815383	0.27
P19414	Aconitate hydratase, mitochondrial (Aconitase) (EC 4.2.1.3) (Citrate hydro-lyase)	EBI-819202	0.27
Q02159	Ubiquitin-conjugating enzyme E2 7 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 7) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme E2-18 kDa) (Ubiquitin-protein ligase)	EBI-861199	0.00
Q12453	Cytoplasmic export protein 1	EBI-7200346	0.27
Q12306	Ubiquitin-like protein SMT3	EBI-2346559	0.37
P39101	Protein CAJ1	EBI-3653629	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3673762	0.35
P16474	Endoplasmic reticulum chaperone BiP (EC 3.6.4.10) (78 kDa glucose-regulated protein homolog) (GRP-78) (Immunoglobulin heavy chain-binding protein homolog) (BiP)	EBI-3705587	0.35
P0CS90	Import motor subunit, mitochondrial (EC 3.6.4.10) (Endonuclease SceI 75 kDa subunit) (Endo.SceI 75 kDa subunit) (mtHSP70)	EBI-3706579	0.35
P40150	Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb)	EBI-3721422	0.35
P32589	Heat shock protein homolog SSE1 (Chaperone protein MSI3)	EBI-3727438	0.35
P15108	ATP-dependent molecular chaperone HSC82 (82 kDa heat shock cognate protein) (Heat shock protein Hsp90 constitutive isoform)	EBI-3734635	0.35
P33416	Heat shock protein 78, mitochondrial	EBI-3745795	0.35
Q12329	Heat shock protein 42 (42 kDa heat shock protein)	EBI-3750983	0.35
P09435	Heat shock protein SSA3	EBI-3775534	0.35
P38788	Ribosome-associated complex subunit SSZ1 (DnaK-related protein SSZ1) (Heat shock protein 70 homolog SSZ1) (Pleiotropic drug resistance protein 13)	EBI-3790807	0.35
P50875	Transcription factor SPT20	EBI-4376349	0.35
P50102	Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.4.19.12) (Deubiquitinating enzyme 8) (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8)	EBI-4380099	0.35
P38129	Transcription initiation factor TFIID subunit 5 (TAFII-90) (TBP-associated factor 5) (TBP-associated factor 90 kDa)	EBI-4389629	0.35
P32835	GTP-binding nuclear protein GSP1/CNR1 (Chromosome stability protein 17) (GTPase Ran homolog) (Genetic suppressor of PRP20-1)	EBI-11888940	0.37

Cross-References

Database	Links
UNIPROT	P32499 D6VYX5 Q06130
PDB	1UN0 2C1T
Pfam	PF08911 PF00638
PROSITE	PS50196

Nucleoporin NUP2 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Structure Viewer (PDB: 2C1T)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (13 interactors)

Interactions with other proteins (33 interactors)

Cross-References

Database

Links

Description

Description