NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Kinesin heavy chain isoform 5A - Mus musculus - NucEnvDB

Kinesin heavy chain isoform 5A (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Kinesin heavy chain isoform 5A
Accession Code	P33175
Gene	Kif5a
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 1027)
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHIYSMDENLEFH IKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLS ALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETIAKLEAELSRWRNGENVPETERLAGEDSALG AELCEETPVNDNSSIVVRIAPEERQKYEEEIRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAAKDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELS QKVATMLSLESELQRLQEVSGHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKSVVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTV ELKKRHLEESYDSLSDELARLQAHETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDEINEKQKTIDELKDLNQKLQLELEKLQADYERLKNEENEKSAKLQELTFLYERHEQSKQDL KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYKSSG KRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQAAPSSTSDMYFASSGATSVAPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q6QLM7}. Cytoplasm, cytoskeleton {By SimilarityUniProtKB:Q6QLM7}. Perikaryon {By SimilarityUniProtKB:Q6QLM7}. Note=Concentrated in the cell body of the neurons, particularly in the perinuclear region. {By SimilarityUniProtKB:Q6QLM7}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Apical Dendrite (GO:0097440) Axon (GO:0030424) Axon Cytoplasm (GO:1904115) Central Region Of Growth Cone (GO:0090724) Ciliary Rootlet (GO:0035253) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dendrite (GO:0030425) Dendrite Cytoplasm (GO:0032839) Kinesin Complex (GO:0005871) Microtubule (GO:0005874) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) P-Body (GO:0000932) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Microtubule-dependent motor required for slow axonal transport of neurofilament proteins (NFH, NFM and NFL) (PubMed:12682084). Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a ZFYVE27-dependent manner. The ZFYVE27-KIF5A complex contributes to the vesicular transport of VAPA, VAPB, SURF4, RAB11A, RAB11B and RTN3 proteins in neurons (PubMed:21976701). Required for anterograde axonal transportation of MAPK8IP3/JIP3 which is essential for MAPK8IP3/JIP3 function in axon elongation (By similarity). {By SimilarityUniProtKB:Q6QLM7, Experimental EvidencePubMed:12682084, Experimental EvidencePubMed:21976701}.
Assigned Ontology terms

Biological Process	Anterograde Axonal Protein Transport (GO:0099641) Anterograde Dendritic Transport Of Neurotransmitter Receptor Complex (GO:0098971) Axon Guidance (GO:0007411) Cytoskeleton-Dependent Intracellular Transport (GO:0030705) Microtubule-Based Movement (GO:0007018) Retrograde Neuronal Dense Core Vesicle Transport (GO:1990049) Synaptic Vesicle Transport (GO:0048489) Vesicle-Mediated Transport (GO:0016192)
Molecular Function	ATP Binding (GO:0005524) ATP Hydrolysis Activity (GO:0016887) Kinesin Binding (GO:0019894) Microtubule Binding (GO:0008017) Microtubule Motor Activity (GO:0003777) Plus-End-Directed Microtubule Motor Activity (GO:0008574) Protein-Containing Complex Binding (GO:0044877) Scaffold Protein Binding (GO:0097110)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O08788	Dynactin subunit 1	EBI-8013466	0.40
P35922	Fragile X messenger ribonucleoprotein 1	EBI-16728828	0.35
Interactions with other proteins (10 interactors)

Partner (UniProt)		IntAct	Confidence score
Q61026	Nuclear receptor coactivator 2 (NCoA-2) (Glucocorticoid receptor-interacting protein 1) (GRIP-1) (Steroid receptor coactivator 2) (SRC-2) (Transcriptional intermediary factor 2)	EBI-8310937	0.37
O70585	Dystrobrevin beta (DTN-B) (mDTN-BDTN-B) (Beta-dystrobrevin)	EBI-349734	0.70
O35668	Huntingtin-associated protein 1 (HAP-1)	EBI-8013423	0.40
Q96NW4	Ankyrin repeat domain-containing protein 27 (VPS9 domain-containing protein)	EBI-6125974	0.52
P50516	V-type proton ATPase catalytic subunit A (V-ATPase subunit A) (EC 7.1.2.2) (V-ATPase 69 kDa subunit) (Vacuolar proton pump subunit alpha)	EBI-6272793	0.35
P54256	Huntingtin-associated protein 1 (HAP-1)	EBI-9652128	0.40
P83510	Traf2 and NCK-interacting protein kinase (EC 2.7.11.1)	EBI-16734044	0.35
Q62108	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	EBI-16724752	0.35
Q9D415	Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1)	EBI-16725590	0.35
Q4ACU6	SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) (SPANK-2)	EBI-26572965	0.35

Cross-References

Database	Links
UNIPROT	P33175 Q5DTP1 Q6PDY7 Q9Z2F9
Pfam	PF00225
PROSITE	PS00411 PS50067

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK