NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

ATP-dependent RNA helicase glh-1 - Caenorhabditis elegans - NucEnvDB

ATP-dependent RNA helicase glh-1 (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	ATP-dependent RNA helicase glh-1
Accession Code	P34689
Gene	glh
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 763)
MSDGWSDSESAAKAKTGFGSGGGFGGGNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSAT GFGSGGGSFGGGNSGFGEGGHGGGERNNNCFNCQQPGHRSSDCPEPRKEREPRVCYNCQQPGHTSRECTEERKPREGRTGGFGGGAGFGNNGGNDGFGGDGGFGGGEERGPMKCFNCKGEGHRSAECPEP PRGCFNCGEQGHRSNECPNPAKPREGVEGEGPKATYVPVEDNMEDVFNMQKISEGLMFNKFFDAEVKLTSSEKTVGIKPCKTFAEANLTETMQKNVAHAGYSKTTPIQQYALPLVHQGYDIMACAQTGSG KTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMMEIKPVYGGLAVGYNKGQIEKGATIIVGTVGRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIETIVNY DSMPRKENRQTLMFSATFPDSVQEAARAFLRENYVMIAIDKIGAANKCVLQEFERCERSEKKDKLLELLGIDIDSYTTEKSAEVYTKKTMVFVSQRAMADTLASILSSAQVPAITIHGAREQRERSEALR QFRNGSKPVLIATAVAERGLDIKGVDHVINYDMPDNIDDYIHRIGRTGRVGNSGRATSFISEDCSLLSELVGVLADAQQIVPDWMQGAAGGNYGASGFGSSVPTQVPQDEEGW

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:17699606, Experimental EvidencePubMed:21402787}. Cytoplasmic granule {Experimental EvidencePubMed:17699606}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:17699606}. Note=Perinuclear localization in germ cells but disperses into particles in cellularized oocytes. Component of P granules. {Experimental EvidencePubMed:17699606}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Nucleus (GO:0005634) P Granule (GO:0043186) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Probable ATP-binding RNA helicase (PubMed:8415696). May act redundantly with the P-granule component glh-4 to regulate the formation of the granular structure of P-granules in embryos (PubMed:21402787, PubMed:24746798). Plays a role in positively regulating the localization of pgl-1 to P-granules (PubMed:18234720). May play a role in transgenerational epigenetic inheritance (PubMed:28533440). May protect somatic cells from excessive apoptosis during normal development (PubMed:27650246). {Experimental EvidencePubMed:18234720, Experimental EvidencePubMed:21402787, Experimental EvidencePubMed:24746798, Experimental EvidencePubMed:27650246, Curator InferencePubMed:28533440, Curator InferencePubMed:8415696}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Gamete Generation (GO:0007276) Germ Cell Development (GO:0007281) Post-Embryonic Development (GO:0009791) RNA Metabolic Process (GO:0016070)
Molecular Function	ATP Binding (GO:0005524) ATP Hydrolysis Activity (GO:0016887) DEAD/H-Box RNA Helicase Binding (GO:0017151) JUN Kinase Binding (GO:0008432) Protein Self-Association (GO:0043621) RNA Binding (GO:0003723) RNA Helicase Activity (GO:0003724) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P34689	Self	EBI-1571975	0.40
Interactions with other proteins (4 interactors)

Partner (UniProt)		IntAct	Confidence score
P91001	COP9 signalosome complex subunit 5 (Signalosome subunit 5) (EC 3.4.-.-) (JAB1 homolog)	EBI-1571788	0.51
O44408	GLH-binding kinase 1 (EC 2.7.11.24)	EBI-1571866	0.40
Q9U3F4	Zyxin	EBI-1571938	0.40
O01836	ATP-dependent RNA helicase glh-3 (EC 3.6.4.13) (Germline helicase 3)	EBI-1571991	0.40

Cross-References

Database	Links
UNIPROT	P34689 Q22873 Q7KQH5 Q9TXH4
Pfam	PF00270 PF00271 PF00098
PROSITE	PS00039 PS51192 PS51194 PS51195 PS50158

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK