NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Cyclin-dependent kinase 11B - Rattus norvegicus - NucEnvDB

Cyclin-dependent kinase 11B (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Cyclin-dependent kinase 11B
Accession Code	P46892
Gene	Cdk11b
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 436)
MKSEKSRTTSWLFQSHEVTEILGRVKKNRKKLVKGLHRAGPPPEKNYLPDSPALSPIELKQELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPLTSIREINTI LKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLTHAGILKVGDFGLAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAC DMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDIGTPSEKIWPGYSELPAVKKMTFSELPYNNLRKRFGALLSDQGFDLMNKFLTYYPGRRINAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQCVKR GTSPKPPEGGLGYSQLGDDDLKETGFHLTTTNDGAVSCRPWCSLLF

Subcellular Location

Description
Cytoplasm. Nucleus membrane; Peripheral membrane protein. Endomembrane system; Peripheral membrane protein. Cytoplasm, perinuclear region.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Nuclear Membrane (GO:0031965) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Plays multiple roles in cell cycle progression, cytokinesis and apoptosis. Involved in pre-mRNA splicing in a kinase activity- dependent manner. May act as a negative regulator of normal cell cycle progression. {By SimilarityUniProtKB:P21127}.
Assigned Ontology terms

Biological Process	Blastocyst Development (GO:0001824) Cell Cycle (GO:0007049) Negative Regulation Of Apoptotic Signaling Pathway (GO:2001234) Protein Phosphorylation (GO:0006468) Regulation Of Cell Growth (GO:0001558) Regulation Of Mitotic Cell Cycle (GO:0007346) Regulation Of Mitotic Nuclear Division (GO:0007088) Regulation Of MRNA Processing (GO:0050684)
Molecular Function	ATP Binding (GO:0005524) Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0004693) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674)

Cross-References

Database	Links
UNIPROT	P46892
Pfam	PF00069
PROSITE	PS50011 PS00108

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK